BLASTX nr result
ID: Sinomenium21_contig00051503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00051503 (349 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006854920.1| hypothetical protein AMTR_s00052p00103370 [A... 65 1e-08 ref|XP_003634944.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >ref|XP_006854920.1| hypothetical protein AMTR_s00052p00103370 [Amborella trichopoda] gi|548858645|gb|ERN16387.1| hypothetical protein AMTR_s00052p00103370 [Amborella trichopoda] Length = 367 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/64 (46%), Positives = 41/64 (64%) Frame = +3 Query: 6 NLNYXXXXXXXXXXXXVIEAREILVDMITKGLRPNFSVYVKVMKDLHRLGMKDMVIDLKS 185 N+NY ++EA ILV+MI KGL+PNF V++KV+KDL G ++M +DLK Sbjct: 294 NMNYSLLSSLLRKSGKIVEAHAILVEMIDKGLKPNFPVFIKVVKDLSHAGFREMGLDLKC 353 Query: 186 RFMK 197 RF K Sbjct: 354 RFSK 357 >ref|XP_003634944.1| PREDICTED: pentatricopeptide repeat-containing protein At5g16420, mitochondrial-like [Vitis vinifera] Length = 582 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/49 (51%), Positives = 38/49 (77%) Frame = +3 Query: 54 VIEAREILVDMITKGLRPNFSVYVKVMKDLHRLGMKDMVIDLKSRFMKL 200 +I A++IL++MI KGL+PNFSVY +V++ L + G +D+ DL+SRF L Sbjct: 525 LISAQKILIEMIEKGLKPNFSVYKRVLEHLDKSGREDLAGDLRSRFSSL 573