BLASTX nr result
ID: Sinomenium21_contig00051201
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00051201 (438 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224290.1| hypothetical protein PRUPE_ppa020085mg, part... 41 5e-06 ref|XP_007206246.1| hypothetical protein PRUPE_ppa015607mg, part... 41 5e-06 ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, part... 40 6e-06 >ref|XP_007224290.1| hypothetical protein PRUPE_ppa020085mg, partial [Prunus persica] gi|462421226|gb|EMJ25489.1| hypothetical protein PRUPE_ppa020085mg, partial [Prunus persica] Length = 1117 Score = 40.8 bits (94), Expect(2) = 5e-06 Identities = 18/45 (40%), Positives = 29/45 (64%) Frame = +1 Query: 136 TLFLLEGEETYLQRTLDIVECLCKASGLRVNLSKSTPLVINTEED 270 T+FLL+G+E Y L +++ C+ SG+++N +KS L IN D Sbjct: 668 TIFLLDGKEEYWLNLLQLLKLFCEVSGMKINKAKSCILGINFSTD 712 Score = 35.0 bits (79), Expect(2) = 5e-06 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Frame = +2 Query: 2 DHLSPFLFTLVVDTLNRMME--WERNVVW*PVSG*GSCGNSPLQFA 133 D LSPFLFTLV D L+R++E + N+V VSG S LQFA Sbjct: 620 DPLSPFLFTLVSDVLSRIIERAQDVNLVHGIVSGHDQVEVSHLQFA 665 >ref|XP_007206246.1| hypothetical protein PRUPE_ppa015607mg, partial [Prunus persica] gi|462401888|gb|EMJ07445.1| hypothetical protein PRUPE_ppa015607mg, partial [Prunus persica] Length = 928 Score = 40.8 bits (94), Expect(2) = 5e-06 Identities = 18/45 (40%), Positives = 29/45 (64%) Frame = +1 Query: 136 TLFLLEGEETYLQRTLDIVECLCKASGLRVNLSKSTPLVINTEED 270 T+FLL+G+E Y L +++ C+ SG+++N +KS L IN D Sbjct: 432 TIFLLDGKEEYWLNLLQLLKLFCEVSGMKINKAKSCILGINFSTD 476 Score = 35.0 bits (79), Expect(2) = 5e-06 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Frame = +2 Query: 2 DHLSPFLFTLVVDTLNRMME--WERNVVW*PVSG*GSCGNSPLQFA 133 D LSPFLFTLV D L+R++E + N+V VSG S LQFA Sbjct: 384 DPLSPFLFTLVSDVLSRIIERAQDVNLVHGIVSGHDQVEVSHLQFA 429 >ref|XP_007212580.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica] gi|462408445|gb|EMJ13779.1| hypothetical protein PRUPE_ppa015871mg, partial [Prunus persica] Length = 1499 Score = 40.0 bits (92), Expect(2) = 6e-06 Identities = 18/45 (40%), Positives = 28/45 (62%) Frame = +1 Query: 136 TLFLLEGEETYLQRTLDIVECLCKASGLRVNLSKSTPLVINTEED 270 T+FLL+G+E Y L +++ C SG+++N +KS L IN D Sbjct: 981 TIFLLDGKEEYWLNLLQLLKLFCDVSGMKINKAKSCILGINFSTD 1025 Score = 35.4 bits (80), Expect(2) = 6e-06 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 2/46 (4%) Frame = +2 Query: 2 DHLSPFLFTLVVDTLNRMME--WERNVVW*PVSG*GSCGNSPLQFA 133 D LSPFLFTLV D L+R++E + N+V VSG S LQFA Sbjct: 933 DPLSPFLFTLVSDVLSRLIERAQDVNLVHGIVSGHDQVEVSHLQFA 978