BLASTX nr result
ID: Sinomenium21_contig00050723
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00050723 (475 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75156.1| hypothetical protein VITISV_042643 [Vitis vinifera] 36 1e-06 emb|CAN62833.1| hypothetical protein VITISV_012130 [Vitis vinifera] 36 3e-06 emb|CAN70693.1| hypothetical protein VITISV_041975 [Vitis vinifera] 36 4e-06 emb|CAN74795.1| hypothetical protein VITISV_041690 [Vitis vinifera] 36 4e-06 gb|EXB36980.1| hypothetical protein L484_018358 [Morus notabilis] 55 8e-06 >emb|CAN75156.1| hypothetical protein VITISV_042643 [Vitis vinifera] Length = 721 Score = 36.2 bits (82), Expect(3) = 1e-06 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = +2 Query: 371 RLKPLWRITVLGFIWSV*EKRNNRVFSDSFRDVE 472 R K LW+I L IW V ++RNNR+F D R E Sbjct: 651 RGKILWQIACLTLIWMVWQERNNRIFEDKGRTEE 684 Score = 33.9 bits (76), Expect(3) = 1e-06 Identities = 19/51 (37%), Positives = 27/51 (52%) Frame = +3 Query: 60 IETSGSLSCKSFFHNFIDQSSFPPLPGWFFIWKASVPNKVRVLV*LVPQRK 212 + +SGS S KSFF+ S+ F+W + VP+KV+ L LV K Sbjct: 523 LSSSGSFSVKSFFYALSKDSNPLMFLPAKFLWSSKVPSKVKALAWLVAHGK 573 Score = 26.9 bits (58), Expect(3) = 1e-06 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 205 RESESIDYVFLSCPFSRSL*QRL 273 R ESID++FL CP + L RL Sbjct: 599 RNGESIDHLFLHCPVTIGLWHRL 621 >emb|CAN62833.1| hypothetical protein VITISV_012130 [Vitis vinifera] Length = 1621 Score = 36.2 bits (82), Expect(3) = 3e-06 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = +2 Query: 371 RLKPLWRITVLGFIWSV*EKRNNRVFSDSFRDVE 472 R K LW+I L IW V ++RNNR+F D R E Sbjct: 681 RGKILWQIACLTLIWMVWQERNNRIFEDKGRTEE 714 Score = 33.9 bits (76), Expect(3) = 3e-06 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +3 Query: 60 IETSGSLSCKSFFHNFI-DQSSFPPLPGWFFIWKASVPNKVRVLV*LVPQRK 212 + +SGS S KSFF+ D + LP F +W + VP+KV+ L LV K Sbjct: 553 LSSSGSFSVKSFFYALSRDSNPLMFLPAKF-LWSSKVPSKVKALAWLVAHGK 603 Score = 25.4 bits (54), Expect(3) = 3e-06 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 214 ESIDYVFLSCPFSRSL*QRL 273 ESID++FL CP + L RL Sbjct: 632 ESIDHLFLHCPITIGLWHRL 651 >emb|CAN70693.1| hypothetical protein VITISV_041975 [Vitis vinifera] Length = 1795 Score = 36.2 bits (82), Expect(3) = 4e-06 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = +2 Query: 371 RLKPLWRITVLGFIWSV*EKRNNRVFSDSFRDVE 472 R K LW+I L IW V ++RNNR+F D R E Sbjct: 246 RGKILWQIACLTLIWMVWQERNNRIFEDKGRTEE 279 Score = 33.9 bits (76), Expect(3) = 4e-06 Identities = 19/51 (37%), Positives = 27/51 (52%) Frame = +3 Query: 60 IETSGSLSCKSFFHNFIDQSSFPPLPGWFFIWKASVPNKVRVLV*LVPQRK 212 + +SGS S KSFF+ S+ F+W + VP+KV+ L LV K Sbjct: 118 LSSSGSFSVKSFFYALSKDSNPLMFLPAKFLWSSKVPSKVKALAWLVAHGK 168 Score = 25.0 bits (53), Expect(3) = 4e-06 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 214 ESIDYVFLSCPFSRSL*QRL 273 ESID++FL CP + L RL Sbjct: 197 ESIDHLFLHCPVTIGLWHRL 216 >emb|CAN74795.1| hypothetical protein VITISV_041690 [Vitis vinifera] Length = 906 Score = 36.2 bits (82), Expect(3) = 4e-06 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = +2 Query: 371 RLKPLWRITVLGFIWSV*EKRNNRVFSDSFRDVE 472 R K LW+I L IW V ++RNNR+F D R E Sbjct: 833 RGKILWQIACLTLIWMVWQERNNRIFEDKGRTEE 866 Score = 33.9 bits (76), Expect(3) = 4e-06 Identities = 21/52 (40%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +3 Query: 60 IETSGSLSCKSFFHNFI-DQSSFPPLPGWFFIWKASVPNKVRVLV*LVPQRK 212 + +SGS S KSFF+ D + LP F +W + VP+KV+ L LV K Sbjct: 705 LSSSGSFSVKSFFYALSRDSNPLMFLPAKF-LWSSKVPSKVKALAWLVAHGK 755 Score = 25.0 bits (53), Expect(3) = 4e-06 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 214 ESIDYVFLSCPFSRSL*QRL 273 ESID++FL CP + L RL Sbjct: 784 ESIDHLFLHCPVTIGLWHRL 803 >gb|EXB36980.1| hypothetical protein L484_018358 [Morus notabilis] Length = 601 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/40 (52%), Positives = 29/40 (72%) Frame = +3 Query: 60 IETSGSLSCKSFFHNFIDQSSFPPLPGWFFIWKASVPNKV 179 +E SG SCKS F++ +D SFPP P ++F+WK SVP K+ Sbjct: 352 LEGSGIFSCKSLFNSLVDNQSFPPFPFYYFVWKISVPTKI 391