BLASTX nr result
ID: Sinomenium21_contig00050671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00050671 (323 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588515.1| hypothetical protein MTR_1g008050 [Medicago ... 56 6e-06 >ref|XP_003588515.1| hypothetical protein MTR_1g008050 [Medicago truncatula] gi|355477563|gb|AES58766.1| hypothetical protein MTR_1g008050 [Medicago truncatula] Length = 1675 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/42 (52%), Positives = 31/42 (73%) Frame = +1 Query: 187 PSLVDYIMKGKFYKTAIRPAMLYGT*CWAIKK*HTSRLIITK 312 P L+ +KGKFY+TA+RPAMLYGT CW +K H S++ + + Sbjct: 1245 PKLIPLKLKGKFYRTAVRPAMLYGTECWVVKSQHESKVSVAE 1286