BLASTX nr result
ID: Sinomenium21_contig00050377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00050377 (539 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280701.2| PREDICTED: uncharacterized protein LOC100249... 61 2e-07 emb|CBI34578.3| unnamed protein product [Vitis vinifera] 61 2e-07 emb|CAN77043.1| hypothetical protein VITISV_039089 [Vitis vinifera] 61 2e-07 gb|EYU33482.1| hypothetical protein MIMGU_mgv1a0199022mg, partia... 60 4e-07 gb|EYU33481.1| hypothetical protein MIMGU_mgv1a020898mg, partial... 60 4e-07 ref|XP_006343791.1| PREDICTED: serine/threonine-protein kinase f... 60 4e-07 ref|XP_006343790.1| PREDICTED: serine/threonine-protein kinase f... 60 4e-07 gb|EPS68278.1| hypothetical protein M569_06489, partial [Genlise... 60 4e-07 ref|XP_004245464.1| PREDICTED: serine/threonine-protein kinase K... 60 4e-07 ref|XP_006849188.1| hypothetical protein AMTR_s00027p00205150, p... 59 8e-07 ref|XP_006661962.1| PREDICTED: STE20/SPS1-related proline-alanin... 58 2e-06 ref|XP_006661961.1| PREDICTED: STE20/SPS1-related proline-alanin... 58 2e-06 ref|XP_006649261.1| PREDICTED: serine/threonine-protein kinase O... 58 2e-06 ref|XP_006649260.1| PREDICTED: serine/threonine-protein kinase O... 58 2e-06 ref|XP_006589235.1| PREDICTED: serine/threonine-protein kinase B... 58 2e-06 ref|XP_006352211.1| PREDICTED: serine/threonine-protein kinase B... 58 2e-06 ref|XP_007161579.1| hypothetical protein PHAVU_001G081500g [Phas... 58 2e-06 ref|XP_004986008.1| PREDICTED: serine/threonine-protein kinase f... 58 2e-06 ref|XP_004986007.1| PREDICTED: serine/threonine-protein kinase f... 58 2e-06 ref|XP_004986006.1| PREDICTED: serine/threonine-protein kinase f... 58 2e-06 >ref|XP_002280701.2| PREDICTED: uncharacterized protein LOC100249628 [Vitis vinifera] Length = 732 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPGSGYDF +I I A + + +A +S LL+ Q Sbjct: 179 RNTFVGTPCWMAPEVLQPGSGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTIQ 237 >emb|CBI34578.3| unnamed protein product [Vitis vinifera] Length = 729 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPGSGYDF +I I A + + +A +S LL+ Q Sbjct: 176 RNTFVGTPCWMAPEVLQPGSGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTIQ 234 >emb|CAN77043.1| hypothetical protein VITISV_039089 [Vitis vinifera] Length = 1077 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/59 (54%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPGSGYDF +I I A + + +A +S LL+ Q Sbjct: 295 RNTFVGTPCWMAPEVLQPGSGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTIQ 353 >gb|EYU33482.1| hypothetical protein MIMGU_mgv1a0199022mg, partial [Mimulus guttatus] Length = 268 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPG+GYDF +I I A + + +A +S LL+ Q Sbjct: 173 RNTFVGTPCWMAPEVLQPGTGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTIQ 231 >gb|EYU33481.1| hypothetical protein MIMGU_mgv1a020898mg, partial [Mimulus guttatus] Length = 485 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPG+GYDF +I I A + + +A +S LL+ Q Sbjct: 170 RNTFVGTPCWMAPEVLQPGTGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTIQ 228 >ref|XP_006343791.1| PREDICTED: serine/threonine-protein kinase fray2-like isoform X2 [Solanum tuberosum] Length = 711 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPG+GYDF +I I A + + +A +S LL+ Q Sbjct: 174 RNTFVGTPCWMAPEVLQPGTGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTIQ 232 >ref|XP_006343790.1| PREDICTED: serine/threonine-protein kinase fray2-like isoform X1 [Solanum tuberosum] Length = 724 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPG+GYDF +I I A + + +A +S LL+ Q Sbjct: 174 RNTFVGTPCWMAPEVLQPGTGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTIQ 232 >gb|EPS68278.1| hypothetical protein M569_06489, partial [Genlisea aurea] Length = 648 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPG+GYDF +I I A + + +A +S LL+ Q Sbjct: 118 RNTFVGTPCWMAPEVLQPGTGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTIQ 176 >ref|XP_004245464.1| PREDICTED: serine/threonine-protein kinase KIC1-like [Solanum lycopersicum] Length = 707 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPG+GYDF +I I A + + +A +S LL+ Q Sbjct: 174 RNTFVGTPCWMAPEVLQPGTGYDFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTIQ 232 >ref|XP_006849188.1| hypothetical protein AMTR_s00027p00205150, partial [Amborella trichopoda] gi|548852675|gb|ERN10769.1| hypothetical protein AMTR_s00027p00205150, partial [Amborella trichopoda] Length = 739 Score = 58.9 bits (141), Expect = 8e-07 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPGSGY+F +I I A + + +A +S LL+ Q Sbjct: 189 RNTFVGTPCWMAPEVLQPGSGYNFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTIQ 247 >ref|XP_006661962.1| PREDICTED: STE20/SPS1-related proline-alanine-rich protein kinase-like isoform X2 [Oryza brachyantha] Length = 746 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPG+GY+F +I I A + + +A +S LL+ Q Sbjct: 188 RNTFVGTPCWMAPEVLQPGTGYNFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQ 246 >ref|XP_006661961.1| PREDICTED: STE20/SPS1-related proline-alanine-rich protein kinase-like isoform X1 [Oryza brachyantha] Length = 753 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPG+GY+F +I I A + + +A +S LL+ Q Sbjct: 188 RNTFVGTPCWMAPEVLQPGTGYNFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQ 246 >ref|XP_006649261.1| PREDICTED: serine/threonine-protein kinase OSR1-like isoform X2 [Oryza brachyantha] Length = 735 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPG+GY+F +I I A + + +A +S LL+ Q Sbjct: 184 RNTFVGTPCWMAPEVLQPGAGYNFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQ 242 >ref|XP_006649260.1| PREDICTED: serine/threonine-protein kinase OSR1-like isoform X1 [Oryza brachyantha] Length = 736 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPG+GY+F +I I A + + +A +S LL+ Q Sbjct: 184 RNTFVGTPCWMAPEVLQPGAGYNFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQ 242 >ref|XP_006589235.1| PREDICTED: serine/threonine-protein kinase BLUS1-like isoform X2 [Glycine max] Length = 700 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPG+GY+F +I I A + + +A +S LL+ Q Sbjct: 173 RNTFVGTPCWMAPEVLQPGTGYNFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTIQ 231 >ref|XP_006352211.1| PREDICTED: serine/threonine-protein kinase BLUS1-like [Solanum tuberosum] Length = 712 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/28 (82%), Positives = 25/28 (89%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI 85 RNTF GTPCWMAPEVLQPG+GYDF +I Sbjct: 173 RNTFTGTPCWMAPEVLQPGTGYDFKADI 200 >ref|XP_007161579.1| hypothetical protein PHAVU_001G081500g [Phaseolus vulgaris] gi|561035043|gb|ESW33573.1| hypothetical protein PHAVU_001G081500g [Phaseolus vulgaris] Length = 703 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPG+GY+F +I I A + + +A +S LL+ Q Sbjct: 171 RNTFVGTPCWMAPEVLQPGTGYNFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTIQ 229 >ref|XP_004986008.1| PREDICTED: serine/threonine-protein kinase fray2-like isoform X4 [Setaria italica] Length = 699 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPG+GY+F +I I A + + +A +S LL+ Q Sbjct: 152 RNTFVGTPCWMAPEVLQPGTGYNFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQ 210 >ref|XP_004986007.1| PREDICTED: serine/threonine-protein kinase fray2-like isoform X3 [Setaria italica] Length = 734 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPG+GY+F +I I A + + +A +S LL+ Q Sbjct: 186 RNTFVGTPCWMAPEVLQPGTGYNFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQ 244 >ref|XP_004986006.1| PREDICTED: serine/threonine-protein kinase fray2-like isoform X2 [Setaria italica] Length = 732 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +2 Query: 2 RNTFVGTPCWMAPEVLQPGSGYDFNIEI---SIKAGKAPYNYADWSPKKYQTFLLVYSQ 169 RNTFVGTPCWMAPEVLQPG+GY+F +I I A + + +A +S LL+ Q Sbjct: 186 RNTFVGTPCWMAPEVLQPGTGYNFKADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQ 244