BLASTX nr result
ID: Sinomenium21_contig00050099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00050099 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540667.1| PREDICTED: pentatricopeptide repeat-containi... 49 5e-07 >ref|XP_003540667.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic-like [Glycine max] Length = 711 Score = 49.3 bits (116), Expect(2) = 5e-07 Identities = 21/37 (56%), Positives = 30/37 (81%) Frame = -1 Query: 124 KQELDIEDPLVRFFKSRSETASEDPGKEGRKLLQKNR 14 +QE D +DP+ +FFK+R+ +S+DPGKEG+ LQKNR Sbjct: 89 EQEHDPDDPIYKFFKTRTRFSSQDPGKEGKLSLQKNR 125 Score = 30.0 bits (66), Expect(2) = 5e-07 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 4/31 (12%) Frame = -2 Query: 198 VCYCLSPTT----APTPLFHPFLQGED*QNK 118 +C C SP+ +PTP+F P+LQ ++ +N+ Sbjct: 45 LCLCASPSNTSHPSPTPIFLPYLQQQEPENR 75