BLASTX nr result
ID: Sinomenium21_contig00049785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00049785 (448 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007139254.1| hypothetical protein PHAVU_008G014200g [Phas... 102 4e-20 ref|XP_002276196.1| PREDICTED: pentatricopeptide repeat-containi... 102 5e-20 ref|XP_007033247.1| Mitochondrial editing factor 22 [Theobroma c... 101 9e-20 ref|NP_187883.2| mitochondrial editing factor 22 [Arabidopsis th... 100 3e-19 ref|XP_004492095.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_003551818.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 dbj|BAD94552.1| hypothetical protein [Arabidopsis thaliana] 100 3e-19 gb|EXC06936.1| hypothetical protein L484_007616 [Morus notabilis] 99 6e-19 gb|EYU24816.1| hypothetical protein MIMGU_mgv1a026793mg [Mimulus... 99 8e-19 ref|XP_006407296.1| hypothetical protein EUTSA_v10020185mg [Eutr... 99 8e-19 ref|XP_002884925.1| predicted protein [Arabidopsis lyrata subsp.... 99 8e-19 ref|XP_006299513.1| hypothetical protein CARUB_v10015683mg [Caps... 98 1e-18 ref|XP_007217805.1| hypothetical protein PRUPE_ppa026585mg [Prun... 97 2e-18 ref|XP_004304934.1| PREDICTED: pentatricopeptide repeat-containi... 96 5e-18 ref|XP_004170996.1| PREDICTED: pentatricopeptide repeat-containi... 96 7e-18 ref|XP_004143694.1| PREDICTED: pentatricopeptide repeat-containi... 96 7e-18 ref|XP_004972250.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-16 ref|XP_006285932.1| hypothetical protein CARUB_v10007444mg [Caps... 91 2e-16 ref|XP_003628671.1| hypothetical protein MTR_8g063290 [Medicago ... 91 2e-16 ref|XP_002867333.1| pentatricopeptide repeat-containing protein ... 91 2e-16 >ref|XP_007139254.1| hypothetical protein PHAVU_008G014200g [Phaseolus vulgaris] gi|593331658|ref|XP_007139255.1| hypothetical protein PHAVU_008G014200g [Phaseolus vulgaris] gi|561012387|gb|ESW11248.1| hypothetical protein PHAVU_008G014200g [Phaseolus vulgaris] gi|561012388|gb|ESW11249.1| hypothetical protein PHAVU_008G014200g [Phaseolus vulgaris] Length = 727 Score = 102 bits (255), Expect = 4e-20 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLRACVNCHSA KLISKLVEREI+VRDANRFHHFKDG+CSCRDYW Sbjct: 680 ITKNLRACVNCHSAIKLISKLVEREIIVRDANRFHHFKDGLCSCRDYW 727 >ref|XP_002276196.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770 [Vitis vinifera] gi|296081235|emb|CBI17979.3| unnamed protein product [Vitis vinifera] Length = 742 Score = 102 bits (254), Expect = 5e-20 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLRAC+NCHSATKLISKLV REIVVRDANRFHHFK+GVCSCRDYW Sbjct: 695 ITKNLRACINCHSATKLISKLVNREIVVRDANRFHHFKNGVCSCRDYW 742 >ref|XP_007033247.1| Mitochondrial editing factor 22 [Theobroma cacao] gi|508712276|gb|EOY04173.1| Mitochondrial editing factor 22 [Theobroma cacao] Length = 735 Score = 101 bits (252), Expect = 9e-20 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLRAC+NCHSATKLISKLV REIVVRDANRFHHFKDGVCSC DYW Sbjct: 688 ITKNLRACINCHSATKLISKLVNREIVVRDANRFHHFKDGVCSCGDYW 735 >ref|NP_187883.2| mitochondrial editing factor 22 [Arabidopsis thaliana] gi|75274142|sp|Q9LTV8.1|PP224_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g12770 gi|11994419|dbj|BAB02421.1| selenium-binding protein-like [Arabidopsis thaliana] gi|332641723|gb|AEE75244.1| mitochondrial editing factor 22 [Arabidopsis thaliana] Length = 694 Score = 100 bits (248), Expect = 3e-19 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLRACVNCH+ATKLISKLV+REIVVRD NRFHHFKDGVCSC DYW Sbjct: 647 ITKNLRACVNCHAATKLISKLVDREIVVRDTNRFHHFKDGVCSCGDYW 694 >ref|XP_004492095.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Cicer arietinum] Length = 724 Score = 100 bits (248), Expect = 3e-19 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLRACVNCHSA KLISKLVEREI+VRDANRFHHFKDG+CSC DYW Sbjct: 677 ITKNLRACVNCHSAIKLISKLVEREIIVRDANRFHHFKDGLCSCGDYW 724 >ref|XP_003551818.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Glycine max] Length = 727 Score = 100 bits (248), Expect = 3e-19 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLRACVNCHSA KLISKLVEREI+VRDANRFHHFKDG+CSC DYW Sbjct: 680 ITKNLRACVNCHSAIKLISKLVEREIIVRDANRFHHFKDGLCSCGDYW 727 >dbj|BAD94552.1| hypothetical protein [Arabidopsis thaliana] Length = 694 Score = 100 bits (248), Expect = 3e-19 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLRACVNCH+ATKLISKLV+REIVVRD NRFHHFKDGVCSC DYW Sbjct: 647 ITKNLRACVNCHAATKLISKLVDREIVVRDTNRFHHFKDGVCSCGDYW 694 >gb|EXC06936.1| hypothetical protein L484_007616 [Morus notabilis] Length = 734 Score = 99.0 bits (245), Expect = 6e-19 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLRACVNCHSATKLIS+LV REIVVRDANRFHHFKDG CSC DYW Sbjct: 687 ITKNLRACVNCHSATKLISRLVNREIVVRDANRFHHFKDGFCSCGDYW 734 >gb|EYU24816.1| hypothetical protein MIMGU_mgv1a026793mg [Mimulus guttatus] Length = 583 Score = 98.6 bits (244), Expect = 8e-19 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLRACVNCH ATKLISK V+REIVVRDANRFHHFKDG+CSC DYW Sbjct: 536 ITKNLRACVNCHLATKLISKFVDREIVVRDANRFHHFKDGICSCGDYW 583 >ref|XP_006407296.1| hypothetical protein EUTSA_v10020185mg [Eutrema salsugineum] gi|557108442|gb|ESQ48749.1| hypothetical protein EUTSA_v10020185mg [Eutrema salsugineum] Length = 694 Score = 98.6 bits (244), Expect = 8e-19 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLRACVNCH+ATKLISKLV REIVVRD NRFHHFKDGVCSC DYW Sbjct: 647 ITKNLRACVNCHAATKLISKLVGREIVVRDTNRFHHFKDGVCSCGDYW 694 >ref|XP_002884925.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297330765|gb|EFH61184.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 694 Score = 98.6 bits (244), Expect = 8e-19 Identities = 44/48 (91%), Positives = 45/48 (93%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLRACVNCH+ATKLISKLV REIVVRD NRFHHFKDGVCSC DYW Sbjct: 647 ITKNLRACVNCHAATKLISKLVGREIVVRDTNRFHHFKDGVCSCGDYW 694 >ref|XP_006299513.1| hypothetical protein CARUB_v10015683mg [Capsella rubella] gi|482568222|gb|EOA32411.1| hypothetical protein CARUB_v10015683mg [Capsella rubella] Length = 694 Score = 97.8 bits (242), Expect = 1e-18 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLRACVNCH+ATKLISKLV RE VVRD NRFHHFKDGVCSC DYW Sbjct: 647 ITKNLRACVNCHAATKLISKLVGREFVVRDTNRFHHFKDGVCSCNDYW 694 >ref|XP_007217805.1| hypothetical protein PRUPE_ppa026585mg [Prunus persica] gi|462413955|gb|EMJ19004.1| hypothetical protein PRUPE_ppa026585mg [Prunus persica] Length = 715 Score = 97.1 bits (240), Expect = 2e-18 Identities = 44/48 (91%), Positives = 44/48 (91%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLRACVNCHSATKLISKLV REIVVRDA RFHHFKDG CSC DYW Sbjct: 668 ITKNLRACVNCHSATKLISKLVNREIVVRDAKRFHHFKDGRCSCGDYW 715 >ref|XP_004304934.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Fragaria vesca subsp. vesca] Length = 739 Score = 95.9 bits (237), Expect = 5e-18 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKN+RACVNCH+ATKLISKLV REIVVRDA RFHHFKDG CSC DYW Sbjct: 692 ITKNIRACVNCHAATKLISKLVNREIVVRDAKRFHHFKDGFCSCGDYW 739 >ref|XP_004170996.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like, partial [Cucumis sativus] Length = 658 Score = 95.5 bits (236), Expect = 7e-18 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLRAC+NCHSA KLISKLV+REI++RDA RFHHFKDGVCSC D+W Sbjct: 611 ITKNLRACINCHSAIKLISKLVDREIIIRDAKRFHHFKDGVCSCGDFW 658 >ref|XP_004143694.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Cucumis sativus] Length = 673 Score = 95.5 bits (236), Expect = 7e-18 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLRAC+NCHSA KLISKLV+REI++RDA RFHHFKDGVCSC D+W Sbjct: 626 ITKNLRACINCHSAIKLISKLVDREIIIRDAKRFHHFKDGVCSCGDFW 673 >ref|XP_004972250.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Setaria italica] Length = 657 Score = 91.3 bits (225), Expect = 1e-16 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLR C +CHS TK ISK EREI+VRD NRFHHF+DGVCSCRDYW Sbjct: 610 ITKNLRLCEDCHSVTKFISKFTEREIIVRDVNRFHHFRDGVCSCRDYW 657 >ref|XP_006285932.1| hypothetical protein CARUB_v10007444mg [Capsella rubella] gi|482554637|gb|EOA18830.1| hypothetical protein CARUB_v10007444mg [Capsella rubella] Length = 790 Score = 90.9 bits (224), Expect = 2e-16 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 I KNLR C++CH+ATKLISK+ ER IVVRDANRFHHFKDGVCSC DYW Sbjct: 743 IMKNLRVCLDCHTATKLISKITERVIVVRDANRFHHFKDGVCSCGDYW 790 >ref|XP_003628671.1| hypothetical protein MTR_8g063290 [Medicago truncatula] gi|355522693|gb|AET03147.1| hypothetical protein MTR_8g063290 [Medicago truncatula] Length = 659 Score = 90.9 bits (224), Expect = 2e-16 Identities = 39/48 (81%), Positives = 42/48 (87%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 ITKNLR C +CH A KLISK+VEREI+VRD NRFHHFKDGVCSC DYW Sbjct: 612 ITKNLRVCGDCHIAAKLISKIVEREIIVRDTNRFHHFKDGVCSCGDYW 659 >ref|XP_002867333.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297313169|gb|EFH43592.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 792 Score = 90.9 bits (224), Expect = 2e-16 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -3 Query: 446 ITKNLRACVNCHSATKLISKLVEREIVVRDANRFHHFKDGVCSCRDYW 303 I KNLR C++CH+ATKLISK+ ER IVVRDANRFHHFKDGVCSC DYW Sbjct: 745 IIKNLRVCLDCHTATKLISKITERVIVVRDANRFHHFKDGVCSCGDYW 792