BLASTX nr result
ID: Sinomenium21_contig00049493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00049493 (391 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006840453.1| hypothetical protein AMTR_s00045p00173390 [A... 64 2e-08 >ref|XP_006840453.1| hypothetical protein AMTR_s00045p00173390 [Amborella trichopoda] gi|548842171|gb|ERN02128.1| hypothetical protein AMTR_s00045p00173390 [Amborella trichopoda] Length = 990 Score = 64.3 bits (155), Expect = 2e-08 Identities = 36/79 (45%), Positives = 51/79 (64%) Frame = -1 Query: 238 MLKVLSTSCSYGRLRRQSVKFPSSSLFNGGESKSHVVRFFDSLRLSNAINPAFCNRVFYC 59 MLKVLS SC +GRL+ S + P S +GGE +S ++R S++ + +P + RVF+C Sbjct: 1 MLKVLSASCLHGRLQCVSSRLPIHSS-HGGEGRSPLLRLLRSMKSPISGSPYYRRRVFFC 59 Query: 58 SESGDGSGSNPVVEAEAES 2 SESG GS VEA+AE+ Sbjct: 60 SESGGNDGSCETVEAKAEN 78