BLASTX nr result
ID: Sinomenium21_contig00049293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00049293 (404 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20118.3| unnamed protein product [Vitis vinifera] 65 2e-12 gb|ABW74556.1| copia-like pol polyprotein [Boechera divaricarpa] 65 4e-12 emb|CAN62870.1| hypothetical protein VITISV_015928 [Vitis vinifera] 71 1e-10 emb|CAN69396.1| hypothetical protein VITISV_021034 [Vitis vinifera] 58 5e-10 emb|CAN68020.1| hypothetical protein VITISV_003621 [Vitis vinifera] 50 1e-08 dbj|BAG72096.1| Gag-protease-integrase-RT-RNaseH polyprotein [Gl... 45 1e-06 >emb|CBI20118.3| unnamed protein product [Vitis vinifera] Length = 1354 Score = 64.7 bits (156), Expect(2) = 2e-12 Identities = 32/62 (51%), Positives = 40/62 (64%) Frame = -1 Query: 248 FYWIPCPSKGYGIYYPNHSERIVKTSNARFIENVEISMSDKLYNVDIQEVMIHVPIPITS 69 F P SKGY Y PNHS RIV+T NARF+EN EIS S++ VDI+E+ + +P P Sbjct: 1065 FIGYPDKSKGYRFYCPNHSVRIVETGNARFLENGEISGSNEPRKVDIEEIRVDIPPPFLP 1124 Query: 68 NE 63 E Sbjct: 1125 QE 1126 Score = 32.7 bits (73), Expect(2) = 2e-12 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -2 Query: 307 EAKIYNL*EKKLDFRMINNCFIGY 236 EA+IYN EKKLD R ++ FIGY Sbjct: 1045 EARIYNPHEKKLDSRTVSGYFIGY 1068 >gb|ABW74556.1| copia-like pol polyprotein [Boechera divaricarpa] Length = 931 Score = 65.1 bits (157), Expect(2) = 4e-12 Identities = 35/58 (60%), Positives = 38/58 (65%) Frame = -1 Query: 248 FYWIPCPSKGYGIYYPNHSERIVKTSNARFIENVEISMSDKLYNVDIQEVMIHVPIPI 75 F P SKGY Y PNHS RIV+T NARFIEN+E S S K VDIQEV I V P+ Sbjct: 389 FIGYPEKSKGYTFYCPNHSMRIVETGNARFIENIETSGSGKPRKVDIQEVQIKVLPPV 446 Score = 31.6 bits (70), Expect(2) = 4e-12 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -2 Query: 307 EAKIYNL*EKKLDFRMINNCFIGY 236 E K+YN EKKLD R ++ FIGY Sbjct: 369 EVKLYNPHEKKLDSRTVSGFFIGY 392 >emb|CAN62870.1| hypothetical protein VITISV_015928 [Vitis vinifera] Length = 764 Score = 71.2 bits (173), Expect = 1e-10 Identities = 39/74 (52%), Positives = 47/74 (63%), Gaps = 1/74 (1%) Frame = -1 Query: 281 KEIGF*NDQ*LFYWIPCPSKGYGIYYPNHSERIVKTSNARFIENVEISMSDKLY-NVDIQ 105 K++ F F P SKGY YYPNHS +IV+T N RFIEN EI SD+L +IQ Sbjct: 580 KKLDFKTISGYFIDYPMKSKGYRFYYPNHSTKIVETGNXRFIENGEIRGSDQLQKKTNIQ 639 Query: 104 EVMIHVPIPITSNE 63 EV + VP+PITS E Sbjct: 640 EVRVQVPLPITSXE 653 >emb|CAN69396.1| hypothetical protein VITISV_021034 [Vitis vinifera] Length = 2026 Score = 57.8 bits (138), Expect(2) = 5e-10 Identities = 29/62 (46%), Positives = 37/62 (59%) Frame = -1 Query: 248 FYWIPCPSKGYGIYYPNHSERIVKTSNARFIENVEISMSDKLYNVDIQEVMIHVPIPITS 69 F P SKGY Y PNH RIV+T NARF+EN EIS S++ DI+E+ + + P Sbjct: 458 FIGYPDKSKGYXFYCPNHXVRIVETXNARFLENGEISGSNEPRKXDIEEIRVDIXPPFLP 517 Query: 68 NE 63 E Sbjct: 518 QE 519 Score = 31.6 bits (70), Expect(2) = 5e-10 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -2 Query: 307 EAKIYNL*EKKLDFRMINNCFIGY 236 E +IYN EKKLD R I+ FIGY Sbjct: 438 ETRIYNPHEKKLDSRTISGYFIGY 461 >emb|CAN68020.1| hypothetical protein VITISV_003621 [Vitis vinifera] Length = 1180 Score = 50.4 bits (119), Expect(2) = 1e-08 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = -1 Query: 221 GYGIYYPNHSERIVKTSNARFIENVEISMSDKLYNVDIQEVMIHVP 84 GY I YP+ S+ IV+T NARF+EN EIS S++ VDI+E+ + +P Sbjct: 650 GYFIGYPDKSKGIVETGNARFLENGEISGSNEPRKVDIEEIRVDIP 695 Score = 34.3 bits (77), Expect(2) = 1e-08 Identities = 16/26 (61%), Positives = 19/26 (73%) Frame = -2 Query: 313 TLEAKIYNL*EKKLDFRMINNCFIGY 236 T EA+IYN EKKLD R ++ FIGY Sbjct: 630 TAEARIYNPHEKKLDSRTVSGYFIGY 655 >dbj|BAG72096.1| Gag-protease-integrase-RT-RNaseH polyprotein [Glycine max] Length = 1321 Score = 45.4 bits (106), Expect(2) = 1e-06 Identities = 27/55 (49%), Positives = 35/55 (63%) Frame = -1 Query: 227 SKGYGIYYPNHSERIVKTSNARFIENVEISMSDKLYNVDIQEVMIHVPIPITSNE 63 SKGY Y P+H RIV++ NA+FIEN IS SD+L ++ E+ P TSNE Sbjct: 657 SKGYRFYCPHHITRIVESRNAKFIENDLISGSDQLRDLG-SEIDYIESQPSTSNE 710 Score = 32.3 bits (72), Expect(2) = 1e-06 Identities = 16/33 (48%), Positives = 19/33 (57%) Frame = -2 Query: 307 EAKIYNL*EKKLDFRMINNCFIGYLAHPKAMEY 209 E +IYN EKKLD R I+ FIGY K + Sbjct: 630 EVRIYNPQEKKLDPRTISGYFIGYAERSKGYRF 662