BLASTX nr result
ID: Sinomenium21_contig00049251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00049251 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006832912.1| hypothetical protein AMTR_s00095p00129820 [A... 63 4e-08 ref|XP_003591130.1| DNA (cytosine-5)-methyltransferase 3B [Medic... 56 4e-06 >ref|XP_006832912.1| hypothetical protein AMTR_s00095p00129820 [Amborella trichopoda] gi|548837412|gb|ERM98190.1| hypothetical protein AMTR_s00095p00129820 [Amborella trichopoda] Length = 324 Score = 63.2 bits (152), Expect = 4e-08 Identities = 35/93 (37%), Positives = 50/93 (53%) Frame = -3 Query: 303 SQDSDGELGVSDGEEELSSNATSFRAGDLVWAKAMPSTWWPGWICRKSRGKVLVTLFDCK 124 S+D D E GE + F DLVW KA +TWWPG IC K + +VLV+LF + Sbjct: 84 SRDLDEEFVEGSGE---AVGFQGFSNCDLVWVKAFANTWWPGLICAKEKHQVLVSLFAQE 140 Query: 123 RNRYFRESEILDFEKNFQAMSNMARGKSLEAIE 25 +F +S++L FE +F + +GK + E Sbjct: 141 TIEWFDQSKVLTFESHF--TGKVKQGKRIRGFE 171 >ref|XP_003591130.1| DNA (cytosine-5)-methyltransferase 3B [Medicago truncatula] gi|355480178|gb|AES61381.1| DNA (cytosine-5)-methyltransferase 3B [Medicago truncatula] Length = 722 Score = 56.2 bits (134), Expect = 4e-06 Identities = 32/90 (35%), Positives = 42/90 (46%), Gaps = 12/90 (13%) Frame = -3 Query: 237 SFRAGDLVWAKAMPSTWWPGWICR-----------KSRGKVLVTLFDCKRNRYFRESEIL 91 SF GDLVW K WWPG+IC K G VLV F R+F +++ Sbjct: 73 SFEVGDLVWGKVKSHPWWPGYICNEAFASSSARLGKKEGCVLVAFFGDGSYRWFDPVQLI 132 Query: 90 DFEKNFQAMSNMARGKSL-EAIECDLVELG 4 F++NF S + KS A+E + E G Sbjct: 133 PFDENFAEKSKQVKLKSFSNAVEESVEEAG 162