BLASTX nr result
ID: Sinomenium21_contig00049156
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00049156 (430 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224079.1| hypothetical protein PRUPE_ppa015473mg, part... 40 4e-06 >ref|XP_007224079.1| hypothetical protein PRUPE_ppa015473mg, partial [Prunus persica] gi|462421015|gb|EMJ25278.1| hypothetical protein PRUPE_ppa015473mg, partial [Prunus persica] Length = 1419 Score = 39.7 bits (91), Expect(2) = 4e-06 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = -3 Query: 428 VISKLSSCDVLQRRLSFICPSPSWCILCKQ 339 V+ KL++ D LQRR ++C SP WC LC + Sbjct: 1308 VLGKLNTGDTLQRRCPYLCISPHWCALCNK 1337 Score = 36.6 bits (83), Expect(2) = 4e-06 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 3/63 (4%) Frame = -2 Query: 330 RLW*GLLQKLELILVTPSRYSEALSMRIE--GALVKRRI-WCIAILS*MWSIWFE*NKRI 160 +LW LL+++ + V P E S+RI+ G K +I W + + +W++W E N+RI Sbjct: 1354 KLWEPLLKEVNTVWVIPEGCFELFSIRIDALGRGKKAKILWGSLMQAVVWNLWLERNRRI 1413 Query: 159 F*D 151 F D Sbjct: 1414 FED 1416