BLASTX nr result
ID: Sinomenium21_contig00048837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00048837 (496 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007217362.1| hypothetical protein PRUPE_ppa021574mg [Prun... 59 7e-07 gb|EXB31946.1| hypothetical protein L484_013578 [Morus notabilis] 57 3e-06 ref|XP_006840156.1| hypothetical protein AMTR_s00089p00070210 [A... 56 6e-06 ref|XP_002323869.2| pentatricopeptide repeat-containing family p... 55 1e-05 >ref|XP_007217362.1| hypothetical protein PRUPE_ppa021574mg [Prunus persica] gi|462413512|gb|EMJ18561.1| hypothetical protein PRUPE_ppa021574mg [Prunus persica] Length = 994 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/45 (62%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = +1 Query: 4 PDFRTHWALISNLSNSTNKSSGDGG-GFLSNLLSRSGFTGKKDSK 135 PDF THW+LISNLSNS++K + + GFL+ LLS SGF+ +KDSK Sbjct: 946 PDFETHWSLISNLSNSSDKDNANSSRGFLARLLSSSGFSRQKDSK 990 >gb|EXB31946.1| hypothetical protein L484_013578 [Morus notabilis] Length = 1087 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +1 Query: 4 PDFRTHWALISNLSNSTNKSSGDGG-GFLSNLLSRSGFTGKKDSK 135 PDF THW+LI+ L S NKS+ + G GFLS LLS SGF+ K DSK Sbjct: 1041 PDFETHWSLINKLRTSFNKSNNESGQGFLSRLLSESGFSRKTDSK 1085 >ref|XP_006840156.1| hypothetical protein AMTR_s00089p00070210 [Amborella trichopoda] gi|548841855|gb|ERN01831.1| hypothetical protein AMTR_s00089p00070210 [Amborella trichopoda] Length = 1239 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = +1 Query: 1 VPDFRTHWALISNLSNSTNKSSGDGGGFLSNLLSRSGFTGKKDSKG 138 VPDF+THW+LISNLSN +S+ GFLS LLS+SGF K S G Sbjct: 1194 VPDFKTHWSLISNLSNDDKESNNK--GFLSRLLSQSGFLSKDSSLG 1237 >ref|XP_002323869.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550320105|gb|EEF04002.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 1255 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/43 (62%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = +1 Query: 4 PDFRTHWALISNLSNSTNKS-SGDGGGFLSNLLSRSGFTGKKD 129 PDF THW+LISNLSNS++K + GFLS+LL+ SGF+ KKD Sbjct: 1207 PDFDTHWSLISNLSNSSDKDYNKSSQGFLSSLLAGSGFSSKKD 1249