BLASTX nr result
ID: Sinomenium21_contig00048605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00048605 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004247247.1| PREDICTED: uncharacterized protein LOC101256... 39 1e-06 emb|CCA65979.1| hypothetical protein [Beta vulgaris subsp. vulga... 40 5e-06 >ref|XP_004247247.1| PREDICTED: uncharacterized protein LOC101256917 [Solanum lycopersicum] Length = 421 Score = 38.9 bits (89), Expect(2) = 1e-06 Identities = 22/60 (36%), Positives = 38/60 (63%), Gaps = 2/60 (3%) Frame = -2 Query: 269 SKVLANRIKESL--IF**AGIAFRPG*LIQENILMSDKVVRGFSRKNNTPSSLKKINLAK 96 SKV+ NR+ + + + + + F G I ENIL++ ++V ++RKN +P S+ KI+L K Sbjct: 196 SKVITNRMHDVIHNVICDSQVGFILGRKISENILLAHELVNSYTRKNISPRSMLKIDLQK 255 Score = 38.9 bits (89), Expect(2) = 1e-06 Identities = 13/39 (33%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = -1 Query: 105 LGKIYDTIGWCYLQKIV----YPDPFIRWIMWCISVTNF 1 L K+YD++ W +L++++ +PD F +W+M C+ N+ Sbjct: 253 LQKVYDSVEWPFLKQVMVGLGFPDMFTQWVMHCVKTVNY 291 >emb|CCA65979.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1110 Score = 40.0 bits (92), Expect(2) = 5e-06 Identities = 21/60 (35%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = -2 Query: 269 SKVLANRIKESL--IF**AGIAFRPG*LIQENILMSDKVVRGFSRKNNTPSSLKKINLAK 96 SK+L NR+K + + A F PG I +NIL++ +++RG++RK+ +P + K+++ K Sbjct: 528 SKMLTNRMKGIIGEVVNEAQSGFIPGRHIADNILLASELIRGYTRKHMSPRCIMKVDIRK 587 Score = 35.8 bits (81), Expect(2) = 5e-06 Identities = 13/37 (35%), Positives = 23/37 (62%), Gaps = 4/37 (10%) Frame = -1 Query: 99 KIYDTIGWCYLQKIVY----PDPFIRWIMWCISVTNF 1 K YD++ W +L+ ++Y P F+ WIM C+S ++ Sbjct: 587 KAYDSVEWSFLETLLYEFGFPSRFVGWIMECVSTVSY 623