BLASTX nr result
ID: Sinomenium21_contig00048514
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00048514 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006856010.1| hypothetical protein AMTR_s00059p00038420 [A... 55 8e-06 >ref|XP_006856010.1| hypothetical protein AMTR_s00059p00038420 [Amborella trichopoda] gi|548859869|gb|ERN17477.1| hypothetical protein AMTR_s00059p00038420 [Amborella trichopoda] Length = 173 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +1 Query: 214 LPYYE*SFFRDIRYPEHSCSLEQLSVLMEESVIIDKKLGRIL 339 L Y+ F RDIR PEH SLEQLSVL EES+ +D+KLGRIL Sbjct: 51 LSYFAFYFVRDIRDPEHPYSLEQLSVLSEESITVDEKLGRIL 92