BLASTX nr result
ID: Sinomenium21_contig00048464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00048464 (441 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35295.3| unnamed protein product [Vitis vinifera] 110 3e-22 ref|XP_002271266.1| PREDICTED: pentatricopeptide repeat-containi... 110 3e-22 emb|CAN61464.1| hypothetical protein VITISV_005683 [Vitis vinifera] 109 3e-22 ref|XP_007210149.1| hypothetical protein PRUPE_ppa024340mg [Prun... 108 8e-22 ref|XP_006389523.1| pentatricopeptide repeat-containing family p... 107 2e-21 ref|XP_004982266.1| PREDICTED: pentatricopeptide repeat-containi... 107 2e-21 gb|AAL73981.1|AF466201_10 putative vegetative storage protein [S... 107 2e-21 ref|XP_004966367.1| PREDICTED: pentatricopeptide repeat-containi... 105 7e-21 ref|XP_003563529.1| PREDICTED: pentatricopeptide repeat-containi... 105 7e-21 gb|AFW63848.1| hypothetical protein ZEAMMB73_561595 [Zea mays] 104 1e-20 gb|AFW63847.1| hypothetical protein ZEAMMB73_561595 [Zea mays] 104 1e-20 ref|NP_001046155.2| Os02g0191200 [Oryza sativa Japonica Group] g... 103 2e-20 ref|XP_007160570.1| hypothetical protein PHAVU_002G332900g [Phas... 103 2e-20 ref|XP_004506659.1| PREDICTED: pentatricopeptide repeat-containi... 103 2e-20 ref|XP_003567560.1| PREDICTED: pentatricopeptide repeat-containi... 103 3e-20 dbj|BAK05962.1| predicted protein [Hordeum vulgare subsp. vulgare] 102 4e-20 ref|XP_006647005.1| PREDICTED: pentatricopeptide repeat-containi... 102 6e-20 gb|EAZ15030.1| hypothetical protein OsJ_04972 [Oryza sativa Japo... 102 6e-20 dbj|BAD87043.1| vegetative storage protein-like [Oryza sativa Ja... 102 6e-20 gb|EMT26579.1| hypothetical protein F775_06134 [Aegilops tauschii] 102 7e-20 >emb|CBI35295.3| unnamed protein product [Vitis vinifera] Length = 645 Score = 110 bits (274), Expect = 3e-22 Identities = 48/64 (75%), Positives = 55/64 (85%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIAFGIL+L+ PI VTKNLRVCGDCH+AIK +T+IT R I VRDA+RFHHF +GTCNC Sbjct: 582 AIAFGILNLKAGRPILVTKNLRVCGDCHTAIKFMTLITKREITVRDANRFHHFKNGTCNC 641 Query: 183 GDFW 194 GDFW Sbjct: 642 GDFW 645 >ref|XP_002271266.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610 [Vitis vinifera] Length = 785 Score = 110 bits (274), Expect = 3e-22 Identities = 48/64 (75%), Positives = 55/64 (85%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIAFGIL+L+ PI VTKNLRVCGDCH+AIK +T+IT R I VRDA+RFHHF +GTCNC Sbjct: 722 AIAFGILNLKAGRPILVTKNLRVCGDCHTAIKFMTLITKREITVRDANRFHHFKNGTCNC 781 Query: 183 GDFW 194 GDFW Sbjct: 782 GDFW 785 >emb|CAN61464.1| hypothetical protein VITISV_005683 [Vitis vinifera] Length = 785 Score = 109 bits (273), Expect = 3e-22 Identities = 48/64 (75%), Positives = 55/64 (85%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIAFGIL+L+ PI VTKNLRVCGDCH+AIK +T+IT R I VRDA+RFHHF +GTCNC Sbjct: 722 AIAFGILNLKAGRPILVTKNLRVCGDCHAAIKFMTVITKREITVRDANRFHHFKNGTCNC 781 Query: 183 GDFW 194 GDFW Sbjct: 782 GDFW 785 >ref|XP_007210149.1| hypothetical protein PRUPE_ppa024340mg [Prunus persica] gi|462405884|gb|EMJ11348.1| hypothetical protein PRUPE_ppa024340mg [Prunus persica] Length = 840 Score = 108 bits (270), Expect = 8e-22 Identities = 48/64 (75%), Positives = 53/64 (82%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIA+ ILSLRP PI VTKNLRVCGDCH+AIK+IT+IT R IIVRD +RFHHF G CNC Sbjct: 777 AIAYAILSLRPGKPILVTKNLRVCGDCHAAIKVITLITKREIIVRDLTRFHHFKDGICNC 836 Query: 183 GDFW 194 DFW Sbjct: 837 ADFW 840 >ref|XP_006389523.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550312346|gb|ERP48437.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 799 Score = 107 bits (267), Expect = 2e-21 Identities = 48/64 (75%), Positives = 53/64 (82%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIAFGILSL P+ I VTKNLRVCGDCH+AIK I+++T R I VRDASRFHHF G CNC Sbjct: 736 AIAFGILSLSPDKHIIVTKNLRVCGDCHTAIKFISLVTKRDITVRDASRFHHFKDGICNC 795 Query: 183 GDFW 194 GDFW Sbjct: 796 GDFW 799 >ref|XP_004982266.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Setaria italica] Length = 816 Score = 107 bits (266), Expect = 2e-21 Identities = 47/64 (73%), Positives = 56/64 (87%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIAFGILSL + IFVTKNLRVCGDCH+AIK +T++ NR+IIVRDA+RFHHF +G C+C Sbjct: 753 AIAFGILSLGEDKTIFVTKNLRVCGDCHTAIKYMTLVRNRSIIVRDANRFHHFKNGQCSC 812 Query: 183 GDFW 194 GDFW Sbjct: 813 GDFW 816 >gb|AAL73981.1|AF466201_10 putative vegetative storage protein [Sorghum bicolor] Length = 779 Score = 107 bits (266), Expect = 2e-21 Identities = 46/64 (71%), Positives = 55/64 (85%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIAFG+LSL + IFVTKNLRVCGDCH+AIK +T++ NR IIVRDA+RFHHF +G C+C Sbjct: 716 AIAFGVLSLNEDKTIFVTKNLRVCGDCHTAIKYMTLVRNRTIIVRDANRFHHFKNGQCSC 775 Query: 183 GDFW 194 GDFW Sbjct: 776 GDFW 779 >ref|XP_004966367.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Setaria italica] Length = 741 Score = 105 bits (262), Expect = 7e-21 Identities = 46/64 (71%), Positives = 53/64 (82%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIAFG++SL PN+PI + KNLRVC DCHSAIKLI+ + NR IIVRD SRFHHF GTC+C Sbjct: 678 AIAFGLISLAPNLPIHIMKNLRVCEDCHSAIKLISKLWNREIIVRDRSRFHHFRDGTCSC 737 Query: 183 GDFW 194 DFW Sbjct: 738 NDFW 741 >ref|XP_003563529.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Brachypodium distachyon] Length = 742 Score = 105 bits (262), Expect = 7e-21 Identities = 46/64 (71%), Positives = 53/64 (82%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIAFG++SL PN+P+ + KNLRVC DCHSAIKLI+ I NR IIVRD SRFHHF GTC+C Sbjct: 679 AIAFGLISLAPNLPLHIIKNLRVCEDCHSAIKLISRIWNREIIVRDRSRFHHFRDGTCSC 738 Query: 183 GDFW 194 DFW Sbjct: 739 NDFW 742 >gb|AFW63848.1| hypothetical protein ZEAMMB73_561595 [Zea mays] Length = 1174 Score = 104 bits (260), Expect = 1e-20 Identities = 52/101 (51%), Positives = 67/101 (66%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIAFG+LSL + IFVTKNLRVCGDCH+AIK +T++ NR IIVRD +RFHHF +G C+C Sbjct: 717 AIAFGVLSLNEDKTIFVTKNLRVCGDCHTAIKYMTLVRNRTIIVRDTNRFHHFKNGQCSC 776 Query: 183 GDFW*RSRQVEKISELMVFARESHACLAWHAALITNLSKPS 305 G+FW +S L++ +WH + NL K S Sbjct: 777 GNFW--------LSILLLMTIHVAFIASWHES--ENLDKVS 807 >gb|AFW63847.1| hypothetical protein ZEAMMB73_561595 [Zea mays] Length = 1274 Score = 104 bits (260), Expect = 1e-20 Identities = 52/101 (51%), Positives = 67/101 (66%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIAFG+LSL + IFVTKNLRVCGDCH+AIK +T++ NR IIVRD +RFHHF +G C+C Sbjct: 717 AIAFGVLSLNEDKTIFVTKNLRVCGDCHTAIKYMTLVRNRTIIVRDTNRFHHFKNGQCSC 776 Query: 183 GDFW*RSRQVEKISELMVFARESHACLAWHAALITNLSKPS 305 G+FW +S L++ +WH + NL K S Sbjct: 777 GNFW--------LSILLLMTIHVAFIASWHES--ENLDKVS 807 >ref|NP_001046155.2| Os02g0191200 [Oryza sativa Japonica Group] gi|46390971|dbj|BAD16484.1| putative pentatricopeptide (PPR) repeat-containing protein [Oryza sativa Japonica Group] gi|50726401|dbj|BAD34012.1| putative pentatricopeptide (PPR) repeat-containing protein [Oryza sativa Japonica Group] gi|255670678|dbj|BAF08069.2| Os02g0191200 [Oryza sativa Japonica Group] Length = 744 Score = 103 bits (258), Expect = 2e-20 Identities = 44/64 (68%), Positives = 53/64 (82%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIAFG+++L PN+P+ + KNLRVC DCHSAIKLI+ + NR IIVRD SRFHHF GTC+C Sbjct: 681 AIAFGLINLAPNLPVHIRKNLRVCEDCHSAIKLISRLWNREIIVRDRSRFHHFREGTCSC 740 Query: 183 GDFW 194 DFW Sbjct: 741 NDFW 744 >ref|XP_007160570.1| hypothetical protein PHAVU_002G332900g [Phaseolus vulgaris] gi|561033985|gb|ESW32564.1| hypothetical protein PHAVU_002G332900g [Phaseolus vulgaris] Length = 779 Score = 103 bits (257), Expect = 2e-20 Identities = 45/64 (70%), Positives = 53/64 (82%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIAFGIL+ RP+ PI VTKNLR+C DCH+A+K +T+IT R I VRDASRFHHF +G CNC Sbjct: 716 AIAFGILNTRPSNPILVTKNLRICVDCHNAVKFMTLITERKITVRDASRFHHFENGICNC 775 Query: 183 GDFW 194 DFW Sbjct: 776 RDFW 779 >ref|XP_004506659.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16610-like isoform X1 [Cicer arietinum] Length = 781 Score = 103 bits (257), Expect = 2e-20 Identities = 47/64 (73%), Positives = 52/64 (81%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIAFGIL+ PN I VTKNLR+C DCHSAIK IT+I+ R IIVRDASRFHHF +G CNC Sbjct: 718 AIAFGILNTNPNNRILVTKNLRICVDCHSAIKFITLISEREIIVRDASRFHHFKNGICNC 777 Query: 183 GDFW 194 DFW Sbjct: 778 QDFW 781 >ref|XP_003567560.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Brachypodium distachyon] Length = 808 Score = 103 bits (256), Expect = 3e-20 Identities = 44/64 (68%), Positives = 54/64 (84%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIAFG+L+L + IFVTKNLRVCGDCH+ IK +T++ RAIIVRDA+RFHHF +G C+C Sbjct: 745 AIAFGVLTLSEDKTIFVTKNLRVCGDCHTVIKYMTLVRKRAIIVRDANRFHHFKNGQCSC 804 Query: 183 GDFW 194 GDFW Sbjct: 805 GDFW 808 >dbj|BAK05962.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 742 Score = 102 bits (255), Expect = 4e-20 Identities = 44/64 (68%), Positives = 52/64 (81%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIAFG++SL PN+P+ + KNLRVC DCHSAIKLI+ + NR IIVRD SRFHHF G C+C Sbjct: 679 AIAFGLVSLAPNLPVHIIKNLRVCEDCHSAIKLISRLWNREIIVRDRSRFHHFRGGVCSC 738 Query: 183 GDFW 194 DFW Sbjct: 739 NDFW 742 >ref|XP_006647005.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Oryza brachyantha] Length = 745 Score = 102 bits (254), Expect = 6e-20 Identities = 44/64 (68%), Positives = 52/64 (81%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIAFG++SL PN+P+ + KNLRVC DCHSAIKLI+ + NR IIVRD SRFHHF G C+C Sbjct: 682 AIAFGLISLAPNLPVHIIKNLRVCEDCHSAIKLISRLWNREIIVRDRSRFHHFREGKCSC 741 Query: 183 GDFW 194 DFW Sbjct: 742 DDFW 745 >gb|EAZ15030.1| hypothetical protein OsJ_04972 [Oryza sativa Japonica Group] Length = 813 Score = 102 bits (254), Expect = 6e-20 Identities = 45/64 (70%), Positives = 54/64 (84%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIA+GILSL + IFVTKNLRVCGDCH+ IK I+++ RAIIVRDA+RFHHF +G C+C Sbjct: 750 AIAYGILSLSEDKTIFVTKNLRVCGDCHTVIKHISLVKRRAIIVRDANRFHHFKNGQCSC 809 Query: 183 GDFW 194 GDFW Sbjct: 810 GDFW 813 >dbj|BAD87043.1| vegetative storage protein-like [Oryza sativa Japonica Group] Length = 698 Score = 102 bits (254), Expect = 6e-20 Identities = 45/64 (70%), Positives = 54/64 (84%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 AIA+GILSL + IFVTKNLRVCGDCH+ IK I+++ RAIIVRDA+RFHHF +G C+C Sbjct: 635 AIAYGILSLSEDKTIFVTKNLRVCGDCHTVIKHISLVKRRAIIVRDANRFHHFKNGQCSC 694 Query: 183 GDFW 194 GDFW Sbjct: 695 GDFW 698 >gb|EMT26579.1| hypothetical protein F775_06134 [Aegilops tauschii] Length = 575 Score = 102 bits (253), Expect = 7e-20 Identities = 41/64 (64%), Positives = 53/64 (82%) Frame = +3 Query: 3 AIAFGILSLRPNMPIFVTKNLRVCGDCHSAIKLITMITNRAIIVRDASRFHHFMSGTCNC 182 A+AFG++SL PN+PI + KNLR+CGDCHS +K++ IT R IVRDA+RFHHF G+C+C Sbjct: 512 ALAFGLISLPPNIPIIIHKNLRICGDCHSFMKVVAHITERLFIVRDANRFHHFKDGSCSC 571 Query: 183 GDFW 194 GDFW Sbjct: 572 GDFW 575