BLASTX nr result
ID: Sinomenium21_contig00047355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00047355 (621 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535405.1| conserved hypothetical protein [Ricinus comm... 97 4e-18 ref|XP_003588318.1| hypothetical protein MTR_1g005920 [Medicago ... 89 1e-15 ref|XP_003591560.1| hypothetical protein MTR_1g088800 [Medicago ... 52 6e-08 ref|XP_003588396.1| hypothetical protein MTR_1g006790 [Medicago ... 52 6e-08 ref|XP_003588294.1| hypothetical protein MTR_1g005480 [Medicago ... 52 6e-08 gb|EYU34039.1| hypothetical protein MIMGU_mgv11b016421mg [Mimulu... 48 1e-06 ref|YP_173442.1| hypothetical protein NitaMp104 [Nicotiana tabac... 59 2e-06 >ref|XP_002535405.1| conserved hypothetical protein [Ricinus communis] gi|223523223|gb|EEF26979.1| conserved hypothetical protein [Ricinus communis] Length = 74 Score = 97.1 bits (240), Expect = 4e-18 Identities = 46/60 (76%), Positives = 51/60 (85%) Frame = +2 Query: 158 EGSQKSIEKIPSRPTGLYVWVLSHLKLGLGRVPLNYRPIIVNKTRK*MDYPAGEKGKENK 337 +G +KSIEKIPSRPTGLYVWVL HLKLGLGRVP YR II+N TRK MD PAGEKGK+ + Sbjct: 15 KGGKKSIEKIPSRPTGLYVWVLFHLKLGLGRVPFFYRSIIINNTRKEMDSPAGEKGKKGR 74 >ref|XP_003588318.1| hypothetical protein MTR_1g005920 [Medicago truncatula] gi|355477366|gb|AES58569.1| hypothetical protein MTR_1g005920 [Medicago truncatula] Length = 178 Score = 89.0 bits (219), Expect = 1e-15 Identities = 49/77 (63%), Positives = 57/77 (74%), Gaps = 4/77 (5%) Frame = -2 Query: 524 GRVNSKVPYSGCKAEKEG*---WAQPHQQPAFPT-RENKTRICVHYLWSGVTILNLLFPI 357 GRVNSKVPYSGC+AE+EG A P + P EN+TRICVHYLWSGVTILNLLFPI Sbjct: 37 GRVNSKVPYSGCQAEEEGERMGTAPPAARVFDPKGMENETRICVHYLWSGVTILNLLFPI 96 Query: 356 SPI*ALPYFLFLSRRQD 306 SP LP+F+F+ + D Sbjct: 97 SP---LPFFIFIVFKPD 110 Score = 52.4 bits (124), Expect(2) = 3e-08 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -3 Query: 85 LKARPKDRSSYLYCLSNPKTIIRGGVLR 2 L++RP DRSSYLYCLSNPK +IRGGVLR Sbjct: 117 LESRPTDRSSYLYCLSNPKILIRGGVLR 144 Score = 32.0 bits (71), Expect(2) = 3e-08 Identities = 17/29 (58%), Positives = 17/29 (58%), Gaps = 7/29 (24%) Frame = -2 Query: 137 LFPPEGKPF-------PDGVVHLCLESPP 72 LFP PF PDGVVHLCLES P Sbjct: 93 LFPISPLPFFIFIVFKPDGVVHLCLESRP 121 >ref|XP_003591560.1| hypothetical protein MTR_1g088800 [Medicago truncatula] gi|355480608|gb|AES61811.1| hypothetical protein MTR_1g088800 [Medicago truncatula] Length = 218 Score = 52.4 bits (124), Expect(2) = 6e-08 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -3 Query: 85 LKARPKDRSSYLYCLSNPKTIIRGGVLR 2 L++RP DRSSYLYCLSNPK +IRGGVLR Sbjct: 157 LESRPTDRSSYLYCLSNPKILIRGGVLR 184 Score = 30.8 bits (68), Expect(2) = 6e-08 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -2 Query: 140 SLFPPEGKPFPDGVVHLCLESPP 72 S+F G PDGVVHLCLES P Sbjct: 139 SVFTIYGVFKPDGVVHLCLESRP 161 >ref|XP_003588396.1| hypothetical protein MTR_1g006790 [Medicago truncatula] gi|355477444|gb|AES58647.1| hypothetical protein MTR_1g006790 [Medicago truncatula] Length = 179 Score = 52.4 bits (124), Expect(2) = 6e-08 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -3 Query: 85 LKARPKDRSSYLYCLSNPKTIIRGGVLR 2 L++RP DRSSYLYCLSNPK +IRGGVLR Sbjct: 118 LESRPTDRSSYLYCLSNPKILIRGGVLR 145 Score = 30.8 bits (68), Expect(2) = 6e-08 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -2 Query: 140 SLFPPEGKPFPDGVVHLCLESPP 72 S+F G PDGVVHLCLES P Sbjct: 100 SVFTIYGVFKPDGVVHLCLESRP 122 >ref|XP_003588294.1| hypothetical protein MTR_1g005480 [Medicago truncatula] gi|355477342|gb|AES58545.1| hypothetical protein MTR_1g005480 [Medicago truncatula] Length = 179 Score = 52.4 bits (124), Expect(2) = 6e-08 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -3 Query: 85 LKARPKDRSSYLYCLSNPKTIIRGGVLR 2 L++RP DRSSYLYCLSNPK +IRGGVLR Sbjct: 118 LESRPTDRSSYLYCLSNPKILIRGGVLR 145 Score = 30.8 bits (68), Expect(2) = 6e-08 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -2 Query: 140 SLFPPEGKPFPDGVVHLCLESPP 72 S+F G PDGVVHLCLES P Sbjct: 100 SVFTIYGVFKPDGVVHLCLESRP 122 >gb|EYU34039.1| hypothetical protein MIMGU_mgv11b016421mg [Mimulus guttatus] Length = 69 Score = 47.8 bits (112), Expect(2) = 1e-06 Identities = 20/26 (76%), Positives = 23/26 (88%) Frame = -2 Query: 428 ENKTRICVHYLWSGVTILNLLFPISP 351 EN+ ICVHYLWSGVTI +L+FPISP Sbjct: 17 ENERGICVHYLWSGVTIQHLIFPISP 42 Score = 30.8 bits (68), Expect(2) = 1e-06 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 468 MGTAPPAARVSDP 430 MGTAPPAARVSDP Sbjct: 1 MGTAPPAARVSDP 13 >ref|YP_173442.1| hypothetical protein NitaMp104 [Nicotiana tabacum] gi|56806606|dbj|BAD83507.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 118 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -2 Query: 428 ENKTRICVHYLWSGVTILNLLFPISPI*ALPYF 330 EN+ RICVHYLWSGVTILNLLFPISP A Y+ Sbjct: 17 ENERRICVHYLWSGVTILNLLFPISPFFAFGYY 49