BLASTX nr result
ID: Sinomenium21_contig00046894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00046894 (599 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007008765.1| Pentatricopeptide repeat-containing protein ... 59 8e-07 ref|XP_007008764.1| Pentatricopeptide repeat-containing protein ... 59 8e-07 ref|XP_004295453.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_002533784.1| pentatricopeptide repeat-containing protein,... 57 3e-06 ref|XP_006415446.1| hypothetical protein EUTSA_v10006701mg [Eutr... 57 5e-06 ref|XP_004495567.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 ref|XP_006303892.1| hypothetical protein CARUB_v10008181mg [Caps... 57 5e-06 ref|NP_174349.1| pentatricopeptide repeat-containing protein [Ar... 57 5e-06 ref|NP_001185117.1| pentatricopeptide repeat-containing protein ... 57 5e-06 ref|XP_002890881.1| EMB2279 [Arabidopsis lyrata subsp. lyrata] g... 57 5e-06 ref|XP_007131486.1| hypothetical protein PHAVU_011G017600g [Phas... 56 7e-06 >ref|XP_007008765.1| Pentatricopeptide repeat-containing protein isoform 2 [Theobroma cacao] gi|508725678|gb|EOY17575.1| Pentatricopeptide repeat-containing protein isoform 2 [Theobroma cacao] Length = 719 Score = 59.3 bits (142), Expect = 8e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 506 QVMFACDKYNLVHEFFRKVEKSSIPNSLNYR 598 +VMFAC KYNLVHEFFRK+EKSS+PN+L YR Sbjct: 487 EVMFACGKYNLVHEFFRKIEKSSMPNALTYR 517 >ref|XP_007008764.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] gi|508725677|gb|EOY17574.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] Length = 845 Score = 59.3 bits (142), Expect = 8e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 506 QVMFACDKYNLVHEFFRKVEKSSIPNSLNYR 598 +VMFAC KYNLVHEFFRK+EKSS+PN+L YR Sbjct: 487 EVMFACGKYNLVHEFFRKIEKSSMPNALTYR 517 >ref|XP_004295453.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 884 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 506 QVMFACDKYNLVHEFFRKVEKSSIPNSLNYR 598 +VMFAC KYNLVHEFF+K++KSSIPN+L YR Sbjct: 526 EVMFACGKYNLVHEFFKKMQKSSIPNALTYR 556 >ref|XP_002533784.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526285|gb|EEF28597.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 856 Score = 57.4 bits (137), Expect = 3e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 506 QVMFACDKYNLVHEFFRKVEKSSIPNSLNYR 598 +VMFAC KYNLVHEFFRKV+KSSIPN+L Y+ Sbjct: 499 EVMFACGKYNLVHEFFRKVQKSSIPNALVYK 529 >ref|XP_006415446.1| hypothetical protein EUTSA_v10006701mg [Eutrema salsugineum] gi|557093217|gb|ESQ33799.1| hypothetical protein EUTSA_v10006701mg [Eutrema salsugineum] Length = 968 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 506 QVMFACDKYNLVHEFFRKVEKSSIPNSLNYR 598 +VM AC+KYNLVHEFFRK++KSSIPN+L YR Sbjct: 627 EVMLACEKYNLVHEFFRKMQKSSIPNALAYR 657 >ref|XP_004495567.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic-like [Cicer arietinum] Length = 883 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 506 QVMFACDKYNLVHEFFRKVEKSSIPNSLNYR 598 +VMF+C KYNLVHEFFRK++KSSIPN L YR Sbjct: 527 EVMFSCGKYNLVHEFFRKLQKSSIPNPLTYR 557 >ref|XP_006303892.1| hypothetical protein CARUB_v10008181mg [Capsella rubella] gi|482572603|gb|EOA36790.1| hypothetical protein CARUB_v10008181mg [Capsella rubella] Length = 1019 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 506 QVMFACDKYNLVHEFFRKVEKSSIPNSLNYR 598 +VM AC+KYNLVHEFFRK++KSSIPN+L YR Sbjct: 675 EVMLACEKYNLVHEFFRKMQKSSIPNALAYR 705 >ref|NP_174349.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75200328|sp|Q9SA76.1|PPR64_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g30610, chloroplastic; AltName: Full=Protein EMBRYO DEFECTIVE 2279; Flags: Precursor gi|4587517|gb|AAD25748.1|AC007060_6 T5I8.6 [Arabidopsis thaliana] gi|332193128|gb|AEE31249.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 1006 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 506 QVMFACDKYNLVHEFFRKVEKSSIPNSLNYR 598 +VM AC+KYNLVHEFFRK++KSSIPN+L YR Sbjct: 636 EVMLACEKYNLVHEFFRKMQKSSIPNALAYR 666 >ref|NP_001185117.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332193129|gb|AEE31250.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 978 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 506 QVMFACDKYNLVHEFFRKVEKSSIPNSLNYR 598 +VM AC+KYNLVHEFFRK++KSSIPN+L YR Sbjct: 636 EVMLACEKYNLVHEFFRKMQKSSIPNALAYR 666 >ref|XP_002890881.1| EMB2279 [Arabidopsis lyrata subsp. lyrata] gi|297336723|gb|EFH67140.1| EMB2279 [Arabidopsis lyrata subsp. lyrata] Length = 913 Score = 56.6 bits (135), Expect = 5e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 506 QVMFACDKYNLVHEFFRKVEKSSIPNSLNYR 598 +VM AC+KYNLVHEFFRK++KSSIPN+L YR Sbjct: 559 EVMLACEKYNLVHEFFRKMQKSSIPNALAYR 589 >ref|XP_007131486.1| hypothetical protein PHAVU_011G017600g [Phaseolus vulgaris] gi|561004486|gb|ESW03480.1| hypothetical protein PHAVU_011G017600g [Phaseolus vulgaris] Length = 888 Score = 56.2 bits (134), Expect = 7e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 506 QVMFACDKYNLVHEFFRKVEKSSIPNSLNYR 598 +VMF+C KYNLVHEFFRK++KS IPNSL YR Sbjct: 523 EVMFSCGKYNLVHEFFRKLQKSFIPNSLTYR 553