BLASTX nr result
ID: Sinomenium21_contig00046712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00046712 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006388324.1| hypothetical protein POPTR_0229s00250g [Popu... 57 3e-06 ref|XP_007219831.1| hypothetical protein PRUPE_ppb013564mg [Prun... 56 5e-06 >ref|XP_006388324.1| hypothetical protein POPTR_0229s00250g [Populus trichocarpa] gi|550310003|gb|ERP47238.1| hypothetical protein POPTR_0229s00250g [Populus trichocarpa] Length = 315 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/57 (47%), Positives = 42/57 (73%) Frame = -2 Query: 173 QDYRIKIYISFFDNHLHIEDFLN*LQIIENFFEYIEIQKEKQVKLVAYKLEGCLAAY 3 Q +R+K+ + F+ L IE FL+ L I+E FF+Y+EI ++K+VKLVAY+L G +A+ Sbjct: 18 QTFRMKMDLPNFNGQLQIEGFLDWLAIVERFFDYMEIPEDKKVKLVAYRLMGGASAW 74 >ref|XP_007219831.1| hypothetical protein PRUPE_ppb013564mg [Prunus persica] gi|462416293|gb|EMJ21030.1| hypothetical protein PRUPE_ppb013564mg [Prunus persica] Length = 964 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/52 (46%), Positives = 38/52 (73%) Frame = -2 Query: 173 QDYRIKIYISFFDNHLHIEDFLN*LQIIENFFEYIEIQKEKQVKLVAYKLEG 18 +DY +K ISFF+ HL +EDFL+ + +E FFE +++ + K VKL A++L+G Sbjct: 43 EDYHMKTEISFFNGHLQVEDFLDWVVEVERFFELMKVPEAKMVKLTAFRLKG 94