BLASTX nr result
ID: Sinomenium21_contig00046088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00046088 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61407.1| hypothetical protein M569_13390, partial [Genlise... 59 5e-07 ref|XP_004245759.1| PREDICTED: uncharacterized protein LOC101253... 57 3e-06 gb|EYU22127.1| hypothetical protein MIMGU_mgv1a023580mg [Mimulus... 55 8e-06 >gb|EPS61407.1| hypothetical protein M569_13390, partial [Genlisea aurea] Length = 728 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/50 (50%), Positives = 34/50 (68%) Frame = -2 Query: 152 LSTAGATLICLLLMVCDIFYAYRCRKPWIPCRFFRIDSFTLTVLAVATKL 3 L AGA+ +C L M D F+ R +KPW PC+FF ++S TLT++ VA KL Sbjct: 22 LYIAGASAVCALFMSLDAFHGIRYKKPWFPCKFFALNSMTLTLIGVAVKL 71 >ref|XP_004245759.1| PREDICTED: uncharacterized protein LOC101253408 [Solanum lycopersicum] Length = 736 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/47 (51%), Positives = 35/47 (74%) Frame = -2 Query: 143 AGATLICLLLMVCDIFYAYRCRKPWIPCRFFRIDSFTLTVLAVATKL 3 A A+L+C+L M D F A+R ++ W PC+FF +++ +LTVLAVA KL Sbjct: 42 AAASLLCILAMAADAFQAFRVKRLWFPCKFFALNAASLTVLAVAMKL 88 >gb|EYU22127.1| hypothetical protein MIMGU_mgv1a023580mg [Mimulus guttatus] Length = 732 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/50 (46%), Positives = 35/50 (70%) Frame = -2 Query: 152 LSTAGATLICLLLMVCDIFYAYRCRKPWIPCRFFRIDSFTLTVLAVATKL 3 L A A+ +C L M D F +R R+ W+PC++F +++F+LT+LAVA KL Sbjct: 40 LYVAAASAVCALAMAADAFRGFRSRRFWLPCKYFSLNAFSLTLLAVAMKL 89