BLASTX nr result
ID: Sinomenium21_contig00045613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00045613 (422 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABG00000.1| retrotransposon protein, putative, Ty1-copia subc... 58 2e-06 gb|AAP21398.1| putative gag-pol polyprotein [Oryza sativa Japoni... 58 2e-06 >gb|ABG00000.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza sativa Japonica Group] Length = 2074 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/49 (51%), Positives = 33/49 (67%) Frame = -2 Query: 151 NKPHSHCQLCGKYGHVVINCWHRFDESFVLSSSAISAQ*ATLDHNAAMN 5 NKP S CQLCGK GHVV +CW+R+DE+F+ S +A +D N M+ Sbjct: 1236 NKPRSTCQLCGKIGHVVADCWYRYDENFIPDSKTAAAASYGVDTNWYMD 1284 >gb|AAP21398.1| putative gag-pol polyprotein [Oryza sativa Japonica Group] Length = 461 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/49 (51%), Positives = 33/49 (67%) Frame = -2 Query: 151 NKPHSHCQLCGKYGHVVINCWHRFDESFVLSSSAISAQ*ATLDHNAAMN 5 NKP S CQLCGK GHVV +CW+R+DE+F+ S +A +D N M+ Sbjct: 157 NKPRSTCQLCGKIGHVVADCWYRYDENFIPDSKTAAAASYGVDTNWYMD 205