BLASTX nr result
ID: Sinomenium21_contig00045231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00045231 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA56254.1| serine proteinase inhibitor [Medicago sativa] 81 2e-13 emb|CAA56253.1| serine proteinase inhibitor [Medicago sativa] 80 2e-13 gb|ACJ86027.1| unknown [Medicago truncatula] gi|388496776|gb|AFK... 80 3e-13 ref|XP_003623935.1| Bowman-Birk type proteinase inhibitor [Medic... 79 5e-13 emb|CAH04454.1| putative trypsin inhibitor [Lens nigricans] 79 7e-13 sp|P80321.2|IBB_MEDSC RecName: Full=Bowman-Birk type proteinase ... 78 1e-12 sp|P85172.1|IBB1_LUPAL RecName: Full=Bowman-Birk type proteinase... 78 1e-12 emb|CAH04453.1| putative trypsin inhibitor [Lens ervoides] 78 1e-12 gb|AAQ10729.1| trypsin inhibitor [Medicago scutellata] 78 1e-12 emb|CAH04448.1| putative trypsin inhibitor [Lens orientalis] gi|... 77 2e-12 emb|CAH04446.1| putative trypsin inhibitor [Lens orientalis] 77 2e-12 emb|CAH04450.1| putative trypsin inhibitor [Lens culinaris subsp... 77 2e-12 emb|CAH04451.1| putative trypsin inhibitor [Lens culinaris subsp... 77 2e-12 emb|CAH04444.1| putative trypsin inhibitor [Lens culinaris] gi|6... 77 2e-12 gb|AFK40073.1| unknown [Lotus japonicus] 77 3e-12 ref|XP_003623947.1| Trypsin inhibitor [Medicago truncatula] gi|3... 76 6e-12 ref|NP_001236539.1| uncharacterized protein LOC100305522 precurs... 76 6e-12 ref|NP_001237767.1| Bowman-Birk type protease inhibitor-like pre... 76 6e-12 emb|CAC24564.1| trypsin inhibitor [Pisum sativum] 75 1e-11 sp|P16346.1|IBBWT_MEDSA RecName: Full=Bowman-Birk type wound-ind... 74 2e-11 >emb|CAA56254.1| serine proteinase inhibitor [Medicago sativa] Length = 113 Score = 80.9 bits (198), Expect = 2e-13 Identities = 31/43 (72%), Positives = 34/43 (79%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PPQCRC DI CH+ACKSC+CTRS PPQCRCTD+T F Y C Sbjct: 70 PPQCRCSDIGETCHSACKSCICTRSYPPQCRCTDITNFCYPKC 112 >emb|CAA56253.1| serine proteinase inhibitor [Medicago sativa] Length = 113 Score = 80.5 bits (197), Expect = 2e-13 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PPQCRC DI CH+ACKSCLCTRS PPQCRCTD+T F Y C Sbjct: 70 PPQCRCTDIGETCHSACKSCLCTRSIPPQCRCTDITNFCYPKC 112 >gb|ACJ86027.1| unknown [Medicago truncatula] gi|388496776|gb|AFK36454.1| unknown [Medicago truncatula] Length = 110 Score = 80.1 bits (196), Expect = 3e-13 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PPQC+C D+K CH+ACKSCLCTRS PPQCRC D+T F Y++C Sbjct: 67 PPQCQCTDVKEKCHSACKSCLCTRSFPPQCRCYDITNFCYSSC 109 >ref|XP_003623935.1| Bowman-Birk type proteinase inhibitor [Medicago truncatula] gi|355498950|gb|AES80153.1| Bowman-Birk type proteinase inhibitor [Medicago truncatula] Length = 242 Score = 79.3 bits (194), Expect = 5e-13 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PPQC+C D+K CH+ACKSCLCTRS PPQCRC D+T F Y +C Sbjct: 67 PPQCQCTDVKEKCHSACKSCLCTRSFPPQCRCYDITNFCYPSC 109 >emb|CAH04454.1| putative trypsin inhibitor [Lens nigricans] Length = 104 Score = 79.0 bits (193), Expect = 7e-13 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PP+CRC DI CH+ACKSCLCTRS PPQCRCTDVT F Y C Sbjct: 61 PPKCRCTDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >sp|P80321.2|IBB_MEDSC RecName: Full=Bowman-Birk type proteinase inhibitor; AltName: Full=MSTI gi|30749513|pdb|1MVZ|A Chain A, Nmr Solution Structure Of A Bowman Birk Inhibitor Isolated From Snail Medic Seeds (Medicago Scutellata) gi|146387522|pdb|2ILN|I Chain I, Crystal Structure Of The Bowman-Birk Inhibitor From Snail Medic Seeds In Complex With Bovine Trypsin Length = 62 Score = 77.8 bits (190), Expect = 1e-12 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PPQC+C D++ CH+ACKSCLCTRS PPQCRC D+T F Y +C Sbjct: 19 PPQCQCTDVREKCHSACKSCLCTRSFPPQCRCYDITDFCYPSC 61 >sp|P85172.1|IBB1_LUPAL RecName: Full=Bowman-Birk type proteinase inhibitor; Short=LaBBI Length = 63 Score = 77.8 bits (190), Expect = 1e-12 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PPQCRC DI CH+ACKSC+CTRS PPQCRC+D+T F Y C Sbjct: 18 PPQCRCTDIGETCHSACKSCICTRSFPPQCRCSDITHFCYKPC 60 >emb|CAH04453.1| putative trypsin inhibitor [Lens ervoides] Length = 104 Score = 77.8 bits (190), Expect = 1e-12 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PP+C C DI CH+ACKSCLCTRS PPQCRCTDVT F Y C Sbjct: 61 PPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKKC 103 >gb|AAQ10729.1| trypsin inhibitor [Medicago scutellata] Length = 110 Score = 77.8 bits (190), Expect = 1e-12 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PPQC+C D++ CH+ACKSCLCTRS PPQCRC D+T F Y +C Sbjct: 67 PPQCQCTDVREKCHSACKSCLCTRSFPPQCRCYDITDFCYPSC 109 >emb|CAH04448.1| putative trypsin inhibitor [Lens orientalis] gi|66840748|emb|CAH04449.1| putative trypsin inhibitor [Lens culinaris subsp. tomentosus] Length = 104 Score = 77.4 bits (189), Expect = 2e-12 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PP+C C DI CH+ACKSCLCTRS PPQCRCTDVT F Y C Sbjct: 61 PPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04446.1| putative trypsin inhibitor [Lens orientalis] Length = 104 Score = 77.4 bits (189), Expect = 2e-12 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PP+C C DI CH+ACKSCLCTRS PPQCRCTDVT F Y C Sbjct: 61 PPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04450.1| putative trypsin inhibitor [Lens culinaris subsp. tomentosus] Length = 104 Score = 77.4 bits (189), Expect = 2e-12 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PP+C C DI CH+ACKSCLCTRS PPQCRCTDVT F Y C Sbjct: 61 PPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04451.1| putative trypsin inhibitor [Lens culinaris subsp. odemensis] gi|66840754|emb|CAH04452.1| putative trypsin inhibitor [Lens culinaris subsp. odemensis] Length = 104 Score = 77.4 bits (189), Expect = 2e-12 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PP+C C DI CH+ACKSCLCTRS PPQCRCTDVT F Y C Sbjct: 61 PPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >emb|CAH04444.1| putative trypsin inhibitor [Lens culinaris] gi|66840740|emb|CAH04445.1| putative trypsin inhibitor [Lens culinaris] gi|66840744|emb|CAH04447.1| putative trypsin inhibitor [Lens orientalis] Length = 104 Score = 77.4 bits (189), Expect = 2e-12 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PP+C C DI CH+ACKSCLCTRS PPQCRCTDVT F Y C Sbjct: 61 PPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >gb|AFK40073.1| unknown [Lotus japonicus] Length = 119 Score = 77.0 bits (188), Expect = 3e-12 Identities = 30/47 (63%), Positives = 34/47 (72%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAACPKTG 146 PPQCRC DI CH+ACK+C+CTRS PPQCRC D+T F Y C G Sbjct: 70 PPQCRCTDIGETCHSACKACICTRSIPPQCRCLDITNFCYDPCTPEG 116 >ref|XP_003623947.1| Trypsin inhibitor [Medicago truncatula] gi|355498962|gb|AES80165.1| Trypsin inhibitor [Medicago truncatula] gi|388499582|gb|AFK37857.1| unknown [Medicago truncatula] Length = 120 Score = 75.9 bits (185), Expect = 6e-12 Identities = 30/43 (69%), Positives = 31/43 (72%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PPQC C DI CH+ACK CLCTRS PPQCRCTD T F Y C Sbjct: 69 PPQCHCADIGEKCHSACKRCLCTRSFPPQCRCTDTTDFCYEPC 111 >ref|NP_001236539.1| uncharacterized protein LOC100305522 precursor [Glycine max] gi|255625791|gb|ACU13240.1| unknown [Glycine max] Length = 117 Score = 75.9 bits (185), Expect = 6e-12 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PPQCRC DI CH+ACK+C+CTRS PPQC C+D+T F Y C Sbjct: 67 PPQCRCSDIGETCHSACKTCICTRSIPPQCHCSDITNFCYEPC 109 >ref|NP_001237767.1| Bowman-Birk type protease inhibitor-like precursor [Glycine max] gi|168259034|gb|ACA23206.1| putative Bowman-Birk type protease inhibitor [Glycine max] Length = 117 Score = 75.9 bits (185), Expect = 6e-12 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PPQCRC DI CH+ACK+C+CTRS PPQC C+D+T F Y C Sbjct: 67 PPQCRCSDIGETCHSACKTCICTRSIPPQCHCSDITNFCYEPC 109 >emb|CAC24564.1| trypsin inhibitor [Pisum sativum] Length = 104 Score = 75.1 bits (183), Expect = 1e-11 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PP+CRC DI CH+ACK+C+CTRS PPQCRC D+T F Y C Sbjct: 61 PPRCRCNDIGETCHSACKTCICTRSLPPQCRCIDITDFCYEKC 103 >sp|P16346.1|IBBWT_MEDSA RecName: Full=Bowman-Birk type wound-induced trypsin inhibitor Length = 58 Score = 74.3 bits (181), Expect = 2e-11 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = +3 Query: 6 PPQCRCGDIKTYCHAACKSCLCTRSNPPQCRCTDVTKFYYAAC 134 PPQCRC DI CH+ACK+CLCT+S PPQC C D+T F Y C Sbjct: 15 PPQCRCTDIGETCHSACKTCLCTKSIPPQCHCADITNFCYPKC 57