BLASTX nr result
ID: Sinomenium21_contig00044955
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00044955 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74485.1| hypothetical protein M569_00274, partial [Genlise... 61 2e-07 >gb|EPS74485.1| hypothetical protein M569_00274, partial [Genlisea aurea] Length = 80 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 2 REGFEPSIVRCSELYRFSRPELSTTRPSLRKRIPIFFLCI 121 REGFEPSIV CS+LYRFSRPELST +PSLRK I I + I Sbjct: 5 REGFEPSIVLCSKLYRFSRPELSTPQPSLRKPISILLVRI 44