BLASTX nr result
ID: Sinomenium21_contig00044689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00044689 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB36980.1| hypothetical protein L484_018358 [Morus notabilis] 57 3e-06 >gb|EXB36980.1| hypothetical protein L484_018358 [Morus notabilis] Length = 601 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/57 (49%), Positives = 37/57 (64%) Frame = +3 Query: 66 SWNFHYHRNLT*RELDDVSQLLGLLGGIKIFSQLQDRRVWTLEQSGLYCLYPCKSFF 236 SWNFH+ RN + REL +V LL L G+++ L+DR VW LE SG ++ CKS F Sbjct: 311 SWNFHFRRNPSERELGEVVGLLSCLEGVRVCVALEDRWVWDLEGSG---IFSCKSLF 364