BLASTX nr result
ID: Sinomenium21_contig00044658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00044658 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGZ91099.1| ribosomal protein S8 (chloroplast) [Myriocarpa co... 79 7e-13 ref|NP_054534.1| ribosomal protein S8 [Nicotiana tabacum] gi|781... 79 9e-13 gb|AHH30474.1| ribosomal protein S8 (chloroplast) [Bartsia inaeq... 79 9e-13 ref|YP_008964070.1| ribosomal protein S8 [Ajuga reptans] gi|5586... 79 9e-13 gb|AGZ90933.1| ribosomal protein S8 (chloroplast) [Cecropia obtu... 79 9e-13 ref|YP_008815973.1| ribosomal protein S8 (chloroplast) [Lindenbe... 79 9e-13 ref|YP_008577528.1| ribosomal protein S8 (chloroplast) [Eucalypt... 79 9e-13 ref|YP_008577358.1| ribosomal protein S8 (chloroplast) [Eucalypt... 79 9e-13 ref|YP_008575658.1| ribosomal protein S8 (chloroplast) [Eucalypt... 79 9e-13 gb|AFV61848.1| ribosomal protein S8 (chloroplast) [Origanum vulg... 79 9e-13 ref|YP_007507147.1| ribosomal protein S8 (chloroplast) [Salvia m... 79 9e-13 ref|YP_007353950.1| ribosomal protein S8 (chloroplast) [Tectona ... 79 9e-13 ref|YP_636334.1| ribosomal protein S8 [Eucalyptus globulus subsp... 79 9e-13 ref|YP_538885.1| ribosomal protein S8 [Solanum bulbocastanum] gi... 79 9e-13 ref|YP_635674.1| ribosomal protein S8 [Solanum tuberosum] gi|394... 79 9e-13 ref|YP_398899.1| ribosomal protein S8 [Nicotiana tomentosiformis... 79 9e-13 ref|NP_783266.1| ribosomal protein S8 [Atropa belladonna] gi|242... 79 9e-13 ref|YP_006503312.1| ribosomal protein S8 (chloroplast) [Gossypiu... 79 9e-13 gb|AEX65473.1| 30S ribosomal protein S8 [Mollugo verticillata] 79 9e-13 gb|AEX65469.1| 30S ribosomal protein S8 [Anredera baselloides] 79 9e-13 >gb|AGZ91099.1| ribosomal protein S8 (chloroplast) [Myriocarpa cordifolia] gi|557163897|gb|AGZ91102.1| ribosomal protein S8 (chloroplast) [Myriocarpa obovata] Length = 134 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMG+VILSTC+GIMTDREARL+GIGGEILCYIW Sbjct: 97 PRILGGMGVVILSTCQGIMTDREARLKGIGGEILCYIW 134 >ref|NP_054534.1| ribosomal protein S8 [Nicotiana tabacum] gi|78102573|ref|YP_358713.1| ribosomal protein S8 [Nicotiana sylvestris] gi|134025|sp|P06363.1|RR8_TOBAC RecName: Full=30S ribosomal protein S8, chloroplastic gi|90111750|sp|Q3C1M0.1|RR8_NICSY RecName: Full=30S ribosomal protein S8, chloroplastic gi|11863|emb|CAA77378.1| ribosomal protein S8 [Nicotiana tabacum] gi|77799600|dbj|BAE46689.1| ribosomal protein S8 [Nicotiana sylvestris] gi|225232|prf||1211235BP ribosomal protein S8 Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >gb|AHH30474.1| ribosomal protein S8 (chloroplast) [Bartsia inaequalis] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >ref|YP_008964070.1| ribosomal protein S8 [Ajuga reptans] gi|558697197|gb|AHA84952.1| ribosomal protein S8 [Ajuga reptans] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >gb|AGZ90933.1| ribosomal protein S8 (chloroplast) [Cecropia obtusifolia] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >ref|YP_008815973.1| ribosomal protein S8 (chloroplast) [Lindenbergia philippensis] gi|557136900|emb|CDI43954.1| ribosomal protein S8 (chloroplast) [Lindenbergia philippensis] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >ref|YP_008577528.1| ribosomal protein S8 (chloroplast) [Eucalyptus erythrocorys] gi|442568768|gb|AGC58937.1| ribosomal protein S8 (chloroplast) [Eucalyptus erythrocorys] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >ref|YP_008577358.1| ribosomal protein S8 (chloroplast) [Eucalyptus microcorys] gi|442568596|gb|AGC58767.1| ribosomal protein S8 (chloroplast) [Eucalyptus microcorys] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >ref|YP_008575658.1| ribosomal protein S8 (chloroplast) [Eucalyptus sieberi] gi|545716882|ref|YP_008575743.1| ribosomal protein S8 (chloroplast) [Eucalyptus elata] gi|545716968|ref|YP_008575828.1| ribosomal protein S8 (chloroplast) [Eucalyptus regnans] gi|442566704|gb|AGC56897.1| ribosomal protein S8 (chloroplast) [Eucalyptus sieberi] gi|442566790|gb|AGC56982.1| ribosomal protein S8 (chloroplast) [Eucalyptus elata] gi|442566876|gb|AGC57067.1| ribosomal protein S8 (chloroplast) [Eucalyptus regnans] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >gb|AFV61848.1| ribosomal protein S8 (chloroplast) [Origanum vulgare subsp. vulgare] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >ref|YP_007507147.1| ribosomal protein S8 (chloroplast) [Salvia miltiorrhiza] gi|401879777|gb|AFQ30964.1| ribosomal protein S8 (chloroplast) [Salvia miltiorrhiza] gi|573461987|emb|CCQ71656.1| ribosomal protein S8 (chloroplast) [Salvia miltiorrhiza] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >ref|YP_007353950.1| ribosomal protein S8 (chloroplast) [Tectona grandis] gi|438687639|emb|CCP47166.1| ribosomal protein S8 (chloroplast) [Tectona grandis] gi|438688323|emb|CCP47255.1| ribosomal protein S8 (chloroplast) [Tectona grandis] gi|438688447|emb|CCP47344.1| ribosomal protein S8 (chloroplast) [Tectona grandis] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >ref|YP_636334.1| ribosomal protein S8 [Eucalyptus globulus subsp. globulus] gi|309322481|ref|YP_003933995.1| ribosomal protein S8 [Eucalyptus grandis] gi|545716280|ref|YP_008575148.1| ribosomal protein S8 (chloroplast) [Eucalyptus obliqua] gi|545716366|ref|YP_008575233.1| ribosomal protein S8 (chloroplast) [Eucalyptus radiata] gi|545716452|ref|YP_008575318.1| ribosomal protein S8 (chloroplast) [Eucalyptus delegatensis] gi|545716538|ref|YP_008575403.1| ribosomal protein S8 (chloroplast) [Eucalyptus verrucata] gi|545716624|ref|YP_008575488.1| ribosomal protein S8 (chloroplast) [Eucalyptus baxteri] gi|545716710|ref|YP_008575573.1| ribosomal protein S8 (chloroplast) [Eucalyptus diversifolia] gi|545717054|ref|YP_008575913.1| ribosomal protein S8 (chloroplast) [Eucalyptus umbra] gi|545717140|ref|YP_008575998.1| ribosomal protein S8 (chloroplast) [Eucalyptus cloeziana] gi|545717226|ref|YP_008576083.1| ribosomal protein S8 (chloroplast) [Eucalyptus patens] gi|545717312|ref|YP_008576168.1| ribosomal protein S8 (chloroplast) [Eucalyptus marginata] gi|545717398|ref|YP_008576253.1| ribosomal protein S8 (chloroplast) [Eucalyptus curtisii] gi|545717484|ref|YP_008576338.1| ribosomal protein S8 (chloroplast) [Eucalyptus melliodora] gi|545717570|ref|YP_008576423.1| ribosomal protein S8 (chloroplast) [Eucalyptus polybractea] gi|545717656|ref|YP_008576508.1| ribosomal protein S8 (chloroplast) [Eucalyptus cladocalyx] gi|545717742|ref|YP_008576593.1| ribosomal protein S8 (chloroplast) [Eucalyptus nitens] gi|545717828|ref|YP_008576678.1| ribosomal protein S8 (chloroplast) [Eucalyptus aromaphloia] gi|545717914|ref|YP_008576763.1| ribosomal protein S8 (chloroplast) [Eucalyptus saligna] gi|545718000|ref|YP_008576848.1| ribosomal protein S8 (chloroplast) [Eucalyptus camaldulensis] gi|545718086|ref|YP_008576933.1| ribosomal protein S8 (chloroplast) [Eucalyptus deglupta] gi|545718172|ref|YP_008577018.1| ribosomal protein S8 (chloroplast) [Eucalyptus spathulata] gi|545718258|ref|YP_008577103.1| ribosomal protein S8 (chloroplast) [Eucalyptus torquata] gi|545718344|ref|YP_008577188.1| ribosomal protein S8 (chloroplast) [Eucalyptus diversicolor] gi|545718430|ref|YP_008577273.1| ribosomal protein S8 (chloroplast) [Eucalyptus salmonophloia] gi|545718602|ref|YP_008577443.1| ribosomal protein S8 (chloroplast) [Eucalyptus guilfoylei] gi|545718774|ref|YP_008577613.1| ribosomal protein S8 (chloroplast) [Corymbia gummifera] gi|545718860|ref|YP_008577698.1| ribosomal protein S8 (chloroplast) [Corymbia maculata] gi|545718946|ref|YP_008577783.1| ribosomal protein S8 (chloroplast) [Corymbia eximia] gi|545719032|ref|YP_008577868.1| ribosomal protein S8 (chloroplast) [Corymbia tessellaris] gi|545719118|ref|YP_008577953.1| ribosomal protein S8 (chloroplast) [Angophora floribunda] gi|545719204|ref|YP_008578038.1| ribosomal protein S8 (chloroplast) [Angophora costata] gi|146335783|sp|Q49KW3.1|RR8_EUCGG RecName: Full=30S ribosomal protein S8, chloroplastic gi|60460842|gb|AAX21062.1| ribosomal protein S8 [Eucalyptus globulus subsp. globulus] gi|308223315|gb|ADO23623.1| ribosomal protein S8 [Eucalyptus grandis] gi|442566188|gb|AGC56387.1| ribosomal protein S8 (chloroplast) [Eucalyptus obliqua] gi|442566274|gb|AGC56472.1| ribosomal protein S8 (chloroplast) [Eucalyptus radiata] gi|442566360|gb|AGC56557.1| ribosomal protein S8 (chloroplast) [Eucalyptus delegatensis] gi|442566446|gb|AGC56642.1| ribosomal protein S8 (chloroplast) [Eucalyptus verrucata] gi|442566532|gb|AGC56727.1| ribosomal protein S8 (chloroplast) [Eucalyptus baxteri] gi|442566618|gb|AGC56812.1| ribosomal protein S8 (chloroplast) [Eucalyptus diversifolia] gi|442566962|gb|AGC57152.1| ribosomal protein S8 (chloroplast) [Eucalyptus umbra] gi|442567048|gb|AGC57237.1| ribosomal protein S8 (chloroplast) [Eucalyptus cloeziana] gi|442567134|gb|AGC57322.1| ribosomal protein S8 (chloroplast) [Eucalyptus patens] gi|442567220|gb|AGC57407.1| ribosomal protein S8 (chloroplast) [Eucalyptus marginata] gi|442567306|gb|AGC57492.1| ribosomal protein S8 (chloroplast) [Eucalyptus curtisii] gi|442567392|gb|AGC57577.1| ribosomal protein S8 (chloroplast) [Eucalyptus melliodora] gi|442567478|gb|AGC57662.1| ribosomal protein S8 (chloroplast) [Eucalyptus melliodora] gi|442567564|gb|AGC57747.1| ribosomal protein S8 (chloroplast) [Eucalyptus polybractea] gi|442567650|gb|AGC57832.1| ribosomal protein S8 (chloroplast) [Eucalyptus cladocalyx] gi|442567736|gb|AGC57917.1| ribosomal protein S8 (chloroplast) [Eucalyptus globulus] gi|442567822|gb|AGC58002.1| ribosomal protein S8 (chloroplast) [Eucalyptus nitens] gi|442567908|gb|AGC58087.1| ribosomal protein S8 (chloroplast) [Eucalyptus aromaphloia] gi|442567994|gb|AGC58172.1| ribosomal protein S8 (chloroplast) [Eucalyptus saligna] gi|442568080|gb|AGC58257.1| ribosomal protein S8 (chloroplast) [Eucalyptus camaldulensis] gi|442568166|gb|AGC58342.1| ribosomal protein S8 (chloroplast) [Eucalyptus deglupta] gi|442568252|gb|AGC58427.1| ribosomal protein S8 (chloroplast) [Eucalyptus spathulata] gi|442568338|gb|AGC58512.1| ribosomal protein S8 (chloroplast) [Eucalyptus torquata] gi|442568424|gb|AGC58597.1| ribosomal protein S8 (chloroplast) [Eucalyptus diversicolor] gi|442568510|gb|AGC58682.1| ribosomal protein S8 (chloroplast) [Eucalyptus salmonophloia] gi|442568682|gb|AGC58852.1| ribosomal protein S8 (chloroplast) [Eucalyptus guilfoylei] gi|442568854|gb|AGC59022.1| ribosomal protein S8 (chloroplast) [Corymbia gummifera] gi|442568940|gb|AGC59107.1| ribosomal protein S8 (chloroplast) [Corymbia maculata] gi|442569026|gb|AGC59192.1| ribosomal protein S8 (chloroplast) [Corymbia eximia] gi|442569112|gb|AGC59277.1| ribosomal protein S8 (chloroplast) [Corymbia tessellaris] gi|442569198|gb|AGC59362.1| ribosomal protein S8 (chloroplast) [Angophora floribunda] gi|442569284|gb|AGC59447.1| ribosomal protein S8 (chloroplast) [Angophora costata] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >ref|YP_538885.1| ribosomal protein S8 [Solanum bulbocastanum] gi|90101674|sp|Q2MIF2.1|RR8_SOLBU RecName: Full=30S ribosomal protein S8, chloroplastic gi|84371930|gb|ABC56248.1| ribosomal protein S8 [Solanum bulbocastanum] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >ref|YP_635674.1| ribosomal protein S8 [Solanum tuberosum] gi|394831136|ref|YP_006503826.1| ribosomal protein S8 (chloroplast) [Datura stramonium] gi|404474560|ref|YP_006666065.1| ribosomal protein S8 (chloroplast) [Capsicum annuum] gi|544163648|ref|YP_008563124.1| ribosomal protein S8 (chloroplast) [Solanum lycopersicum] gi|544170707|ref|AP_004963.1| ribosomal protein S8 (chloroplast) [Solanum lycopersicum] gi|90101673|sp|Q2MI65.1|RR8_SOLLC RecName: Full=30S ribosomal protein S8, chloroplastic gi|90111753|sp|Q2VEE5.1|RR8_SOLTU RecName: Full=30S ribosomal protein S8, chloroplastic gi|82754660|gb|ABB90074.1| ribosomal protein S8 [Solanum tuberosum] gi|84372018|gb|ABC56335.1| ribosomal protein S8 (chloroplast) [Solanum lycopersicum] gi|88656838|gb|ABD47091.1| ribosomal protein S8 [Solanum tuberosum] gi|89241706|emb|CAJ32429.1| ribosomal protein S8 [Solanum lycopersicum] gi|329124617|gb|AEB72174.1| ribosomal protein S8 (chloroplast) [Solanum tuberosum] gi|329124704|gb|AEB72260.1| ribosomal protein S8 (chloroplast) [Solanum tuberosum] gi|350996461|gb|AEQ36973.1| ribosomal protein S8 (chloroplast) [Datura stramonium] gi|350996547|gb|AEQ37058.1| ribosomal protein S8 [Datura stramonium] gi|401065967|gb|AFP90811.1| ribosomal protein S8 (chloroplast) [Capsicum annuum] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >ref|YP_398899.1| ribosomal protein S8 [Nicotiana tomentosiformis] gi|90111751|sp|Q33BZ7.1|RR8_NICTO RecName: Full=30S ribosomal protein S8, chloroplastic gi|80750962|dbj|BAE48038.1| ribosomal protein S8 [Nicotiana tomentosiformis] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >ref|NP_783266.1| ribosomal protein S8 [Atropa belladonna] gi|24212273|sp|Q8S8V8.1|RR8_ATRBE RecName: Full=30S ribosomal protein S8, chloroplastic gi|20068366|emb|CAC88079.1| ribosomal protein S8 [Atropa belladonna] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >ref|YP_006503312.1| ribosomal protein S8 (chloroplast) [Gossypium incanum] gi|335354365|gb|AEH42985.1| ribosomal protein S8 [Gossypium incanum] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >gb|AEX65473.1| 30S ribosomal protein S8 [Mollugo verticillata] Length = 134 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 97 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 134 >gb|AEX65469.1| 30S ribosomal protein S8 [Anredera baselloides] Length = 124 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +2 Query: 2 PRILGGMGIVILSTCRGIMTDREARLEGIGGEILCYIW 115 PRILGGMGIVILST RGIMTDREARLEGIGGEILCYIW Sbjct: 87 PRILGGMGIVILSTSRGIMTDREARLEGIGGEILCYIW 124