BLASTX nr result
ID: Sinomenium21_contig00044184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00044184 (463 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265412.1| PREDICTED: pentatricopeptide repeat-containi... 75 7e-12 gb|EMS63941.1| hypothetical protein TRIUR3_25948 [Triticum urartu] 75 9e-12 dbj|BAJ89270.1| predicted protein [Hordeum vulgare subsp. vulgare] 74 2e-11 ref|XP_004966826.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 tpg|DAA61907.1| TPA: hypothetical protein ZEAMMB73_945776 [Zea m... 74 3e-11 gb|EYU36539.1| hypothetical protein MIMGU_mgv1a025523mg [Mimulus... 73 4e-11 gb|EMT14400.1| hypothetical protein F775_09464 [Aegilops tauschii] 73 4e-11 gb|EMS45498.1| hypothetical protein TRIUR3_12201 [Triticum urartu] 73 4e-11 gb|EXB93195.1| hypothetical protein L484_024533 [Morus notabilis] 73 5e-11 ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 gb|EMT07364.1| Pentatricopeptide repeat-containing protein [Aegi... 73 5e-11 emb|CBI28351.3| unnamed protein product [Vitis vinifera] 73 5e-11 ref|XP_002262885.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 ref|XP_006658280.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 dbj|BAK07481.1| predicted protein [Hordeum vulgare subsp. vulgare] 72 6e-11 gb|EXC01449.1| hypothetical protein L484_022020 [Morus notabilis] 72 8e-11 ref|XP_006656800.1| PREDICTED: pentatricopeptide repeat-containi... 72 8e-11 ref|XP_004970818.1| PREDICTED: pentatricopeptide repeat-containi... 72 8e-11 ref|XP_003557645.1| PREDICTED: pentatricopeptide repeat-containi... 72 8e-11 ref|XP_002438098.1| hypothetical protein SORBIDRAFT_10g007970 [S... 72 8e-11 >ref|XP_002265412.1| PREDICTED: pentatricopeptide repeat-containing protein At1g34160-like [Vitis vinifera] Length = 573 Score = 75.5 bits (184), Expect = 7e-12 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 ICGDCHVVIKLISK+Y II+ DRA FH FK+GSCSC DYW Sbjct: 532 ICGDCHVVIKLISKIYDQEIIVRDRARFHRFKDGSCSCRDYW 573 >gb|EMS63941.1| hypothetical protein TRIUR3_25948 [Triticum urartu] Length = 482 Score = 75.1 bits (183), Expect = 9e-12 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 ICGDCHVV KLISK YG II+ DRA FH F++G CSCGDYW Sbjct: 441 ICGDCHVVAKLISKAYGRVIIIRDRARFHRFEDGQCSCGDYW 482 >dbj|BAJ89270.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 580 Score = 73.9 bits (180), Expect = 2e-11 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 ICGDCHVV KLISK YG II+ DRA FH F++G CSC DYW Sbjct: 539 ICGDCHVVAKLISKAYGRAIIIRDRARFHRFEDGQCSCSDYW 580 >ref|XP_004966826.1| PREDICTED: pentatricopeptide repeat-containing protein At1g34160-like [Setaria italica] Length = 598 Score = 73.6 bits (179), Expect = 3e-11 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 ICGDCHVV KLISKVYG II+ DRA FH F++G CSC DYW Sbjct: 557 ICGDCHVVAKLISKVYGRVIIIRDRARFHRFEDGQCSCRDYW 598 >tpg|DAA61907.1| TPA: hypothetical protein ZEAMMB73_945776 [Zea mays] Length = 584 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 ICGDCH IKLISK+YG II+ D FHHF++GSCSCGDYW Sbjct: 543 ICGDCHNAIKLISKIYGRCIIVRDANRFHHFRKGSCSCGDYW 584 >gb|EYU36539.1| hypothetical protein MIMGU_mgv1a025523mg [Mimulus guttatus] Length = 576 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/42 (73%), Positives = 33/42 (78%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 ICGDCH VIKLISK+Y II+ DR FH FKEGSCSC DYW Sbjct: 535 ICGDCHAVIKLISKLYNREIIVRDRTRFHRFKEGSCSCRDYW 576 >gb|EMT14400.1| hypothetical protein F775_09464 [Aegilops tauschii] Length = 596 Score = 73.2 bits (178), Expect = 4e-11 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 +CGDCH+VIKLISKVY II+ DR+ FHHFK G CSC DYW Sbjct: 555 VCGDCHLVIKLISKVYDREIIVRDRSRFHHFKGGECSCKDYW 596 >gb|EMS45498.1| hypothetical protein TRIUR3_12201 [Triticum urartu] Length = 402 Score = 73.2 bits (178), Expect = 4e-11 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 +CGDCH+VIKLISKVY II+ DR+ FHHFK G CSC DYW Sbjct: 361 VCGDCHLVIKLISKVYDREIIVRDRSRFHHFKGGECSCKDYW 402 >gb|EXB93195.1| hypothetical protein L484_024533 [Morus notabilis] Length = 805 Score = 72.8 bits (177), Expect = 5e-11 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 +C DCH KL+SK+YG II+ DR FHHF+EGSCSCGDYW Sbjct: 764 VCDDCHAATKLLSKIYGRVIIVRDRNRFHHFREGSCSCGDYW 805 >ref|XP_004958944.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Setaria italica] Length = 594 Score = 72.8 bits (177), Expect = 5e-11 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 +CGDCH+ IKLISK+Y II+ DR+ FHHFK GSCSC DYW Sbjct: 553 VCGDCHMAIKLISKIYDREIIVRDRSRFHHFKGGSCSCKDYW 594 >gb|EMT07364.1| Pentatricopeptide repeat-containing protein [Aegilops tauschii] Length = 454 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 ICGDCHVV KLISK YG II+ DRA FH F++G CSC DYW Sbjct: 375 ICGDCHVVAKLISKAYGRVIIIRDRARFHRFEDGQCSCSDYW 416 >emb|CBI28351.3| unnamed protein product [Vitis vinifera] Length = 770 Score = 72.8 bits (177), Expect = 5e-11 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 +CGDCH VIKLISK+ G I++ D FHHFK GSCSCGDYW Sbjct: 729 VCGDCHTVIKLISKIEGRDIVVRDSNRFHHFKGGSCSCGDYW 770 >ref|XP_002262885.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Vitis vinifera] Length = 866 Score = 72.8 bits (177), Expect = 5e-11 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 +CGDCH VIKLISK+ G I++ D FHHFK GSCSCGDYW Sbjct: 825 VCGDCHTVIKLISKIEGRDIVVRDSNRFHHFKGGSCSCGDYW 866 >ref|XP_006658280.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Oryza brachyantha] Length = 537 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 +CGDCHV IKLISKVY II+ DR+ FHHFK G+CSC DYW Sbjct: 496 MCGDCHVAIKLISKVYDREIIVRDRSRFHHFKGGTCSCKDYW 537 >dbj|BAK07481.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 596 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 +CGDCH+VIKLISKVY II+ DR+ FHHFK G CSC DYW Sbjct: 555 MCGDCHLVIKLISKVYDREIIVRDRSRFHHFKGGECSCKDYW 596 >gb|EXC01449.1| hypothetical protein L484_022020 [Morus notabilis] Length = 739 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 +CGDCH V KL+SKVY I+L DR FHHFK+G CSCG+YW Sbjct: 698 VCGDCHAVAKLVSKVYKREILLRDRYRFHHFKDGHCSCGEYW 739 >ref|XP_006656800.1| PREDICTED: pentatricopeptide repeat-containing protein At1g34160-like [Oryza brachyantha] Length = 554 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 ICGDCHVV KLISK YG II+ DRA FH F++G CSC DYW Sbjct: 513 ICGDCHVVAKLISKAYGRVIIIRDRARFHQFEDGECSCKDYW 554 >ref|XP_004970818.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Setaria italica] Length = 517 Score = 72.0 bits (175), Expect = 8e-11 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 +CGDCH IK+++KVYG IIL D FHH K+G+CSCGDYW Sbjct: 476 VCGDCHAAIKMVAKVYGREIILRDANCFHHMKDGACSCGDYW 517 >ref|XP_003557645.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Brachypodium distachyon] Length = 598 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 +CGDCH+ IKLISKVY II+ DR+ FHHFK G+CSC DYW Sbjct: 557 VCGDCHMAIKLISKVYDREIIVRDRSRFHHFKGGACSCKDYW 598 >ref|XP_002438098.1| hypothetical protein SORBIDRAFT_10g007970 [Sorghum bicolor] gi|241916321|gb|EER89465.1| hypothetical protein SORBIDRAFT_10g007970 [Sorghum bicolor] Length = 596 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -1 Query: 202 ICGDCHVVIKLISKVYGHGIILHDRA*FHHFKEGSCSCGDYW 77 ICGDCHVV KLISK YG II+ DRA FH F++G CSC DYW Sbjct: 555 ICGDCHVVAKLISKAYGRVIIIRDRARFHQFEDGQCSCRDYW 596