BLASTX nr result
ID: Sinomenium21_contig00044035
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00044035 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007038050.1| Tetratricopeptide repeat (TPR)-like superfam... 66 6e-09 >ref|XP_007038050.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] gi|508775295|gb|EOY22551.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 507 Score = 65.9 bits (159), Expect = 6e-09 Identities = 35/71 (49%), Positives = 46/71 (64%), Gaps = 6/71 (8%) Frame = +2 Query: 137 PTFRSHQPEFL------HLQLLKRCTQLNQFKQIHTQIIKNSTEQTNFLLAKLVESLVSS 298 P+ S QPE L HLQ+LK+CT L QFKQ+H QIIK + Q + L+KL+++LV S Sbjct: 18 PSKDSKQPEKLTSNKPNHLQILKKCTHLIQFKQVHAQIIKTTLPQADTHLSKLIQALVGS 77 Query: 299 THMDYACRVFD 331 H+ YA V D Sbjct: 78 AHLPYARLVLD 88