BLASTX nr result
ID: Sinomenium21_contig00043932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00043932 (588 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_817236.1| ORF58d [Pinus koraiensis] gi|29469754|gb|AAO740... 60 3e-07 gb|AHV90367.1| ribosomal protein L2 (chloroplast) [Setaria italica] 57 4e-06 gb|ADD63067.1| ribosomal protein L2 [Potamophila parviflora] gi|... 57 4e-06 ref|YP_006503856.1| ribosomal protein L2 (chloroplast) [Datura s... 56 8e-06 ref|XP_003605908.1| 50S ribosomal protein L2 [Medicago truncatul... 56 8e-06 ref|XP_003599582.1| 50S ribosomal protein L2 [Medicago truncatul... 56 8e-06 ref|XP_003590807.1| 50S ribosomal protein L2 [Medicago truncatul... 56 8e-06 >ref|NP_817236.1| ORF58d [Pinus koraiensis] gi|29469754|gb|AAO74082.1| ORF58d [Pinus koraiensis] Length = 58 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +2 Query: 425 LGFGVSLIGFLQ*DKSIVQTALT*RQFPIDIGTFVPKTIISPIIAPLGCQKYL 583 +GF V+ IG + K I+QTAL R FPIDIG F P+ I+SPI+ PLGC+ Y+ Sbjct: 1 MGFAVNPIGCFRSRKLIIQTALRGRTFPIDIGAFGPERIVSPIMTPLGCRIYI 53 >gb|AHV90367.1| ribosomal protein L2 (chloroplast) [Setaria italica] Length = 132 Score = 57.0 bits (136), Expect = 4e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 588 EERYF*HPRGAIIGDIIVFGTKVPISMGNCLHVSAV 481 E+RY HPRGAIIGD IV GTKVPISMGN L +SAV Sbjct: 97 EKRYILHPRGAIIGDTIVSGTKVPISMGNALPLSAV 132 >gb|ADD63067.1| ribosomal protein L2 [Potamophila parviflora] gi|290790877|gb|ADD63133.1| ribosomal protein L2 [Microlaena stipoides] Length = 104 Score = 57.0 bits (136), Expect = 4e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 588 EERYF*HPRGAIIGDIIVFGTKVPISMGNCLHVSAV 481 E+RY HPRGAIIGD IV GTKVPISMGN L +SAV Sbjct: 69 EKRYILHPRGAIIGDTIVSGTKVPISMGNALPLSAV 104 >ref|YP_006503856.1| ribosomal protein L2 (chloroplast) [Datura stramonium] gi|350996490|gb|AEQ37002.1| ribosomal protein L2 (chloroplast) [Datura stramonium] gi|350996578|gb|AEQ37089.1| ribosomal protein L2 [Datura stramonium] Length = 268 Score = 55.8 bits (133), Expect = 8e-06 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -1 Query: 588 EERYF*HPRGAIIGDIIVFGTKVPISMGNCLHVSAV*TIDLS 463 E+RY HPRGAIIGD IV GT+VPI MGN L +SAV I+++ Sbjct: 98 EKRYILHPRGAIIGDTIVSGTEVPIKMGNALPLSAVHNIEIT 139 >ref|XP_003605908.1| 50S ribosomal protein L2 [Medicago truncatula] gi|355506963|gb|AES88105.1| 50S ribosomal protein L2 [Medicago truncatula] Length = 236 Score = 55.8 bits (133), Expect = 8e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 588 EERYF*HPRGAIIGDIIVFGTKVPISMGNCLHVSAV 481 E+RY HPRGAIIGD IV+GT+VPI MGN L +SAV Sbjct: 201 EKRYILHPRGAIIGDTIVYGTEVPIKMGNALPLSAV 236 >ref|XP_003599582.1| 50S ribosomal protein L2 [Medicago truncatula] gi|355488630|gb|AES69833.1| 50S ribosomal protein L2 [Medicago truncatula] Length = 236 Score = 55.8 bits (133), Expect = 8e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 588 EERYF*HPRGAIIGDIIVFGTKVPISMGNCLHVSAV 481 E+RY HPRGAIIGD IV+GT+VPI MGN L +SAV Sbjct: 201 EKRYILHPRGAIIGDTIVYGTEVPIKMGNALPLSAV 236 >ref|XP_003590807.1| 50S ribosomal protein L2 [Medicago truncatula] gi|355479855|gb|AES61058.1| 50S ribosomal protein L2 [Medicago truncatula] Length = 94 Score = 55.8 bits (133), Expect = 8e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 588 EERYF*HPRGAIIGDIIVFGTKVPISMGNCLHVSAV 481 E+RY HPRGAIIGD IV+GT+VPI MGN L +SAV Sbjct: 59 EKRYILHPRGAIIGDTIVYGTEVPIKMGNALPLSAV 94