BLASTX nr result
ID: Sinomenium21_contig00043829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00043829 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30660.3| unnamed protein product [Vitis vinifera] 69 9e-10 ref|XP_002267303.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 emb|CAN75464.1| hypothetical protein VITISV_006518 [Vitis vinifera] 69 9e-10 ref|XP_002305756.1| hypothetical protein POPTR_0004s05320g [Popu... 64 3e-08 ref|XP_004163477.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 ref|XP_004149063.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 gb|EXB59940.1| hypothetical protein L484_013060 [Morus notabilis] 60 2e-07 ref|XP_004485875.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_007212512.1| hypothetical protein PRUPE_ppa017842mg [Prun... 60 4e-07 ref|XP_007025441.1| Tetratricopeptide repeat (TPR)-like superfam... 59 7e-07 ref|XP_007148069.1| hypothetical protein PHAVU_006G178000g [Phas... 59 9e-07 ref|XP_003593731.1| Pentatricopeptide repeat-containing protein ... 59 9e-07 ref|XP_006449472.1| hypothetical protein CICLE_v10014987mg [Citr... 57 2e-06 ref|XP_004301518.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_006467676.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_006467675.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 >emb|CBI30660.3| unnamed protein product [Vitis vinifera] Length = 598 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +3 Query: 207 LSSALQHYIQSDFPSQDQKINAHILKIGFKPNTNISMKLLV 329 LS ALQHYI SDFPS QKI++HILKIGF+PNTN+S+KLL+ Sbjct: 45 LSVALQHYINSDFPSHGQKIHSHILKIGFEPNTNVSIKLLI 85 >ref|XP_002267303.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Vitis vinifera] Length = 533 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +3 Query: 207 LSSALQHYIQSDFPSQDQKINAHILKIGFKPNTNISMKLLV 329 LS ALQHYI SDFPS QKI++HILKIGF+PNTN+S+KLL+ Sbjct: 45 LSVALQHYINSDFPSHGQKIHSHILKIGFEPNTNVSIKLLI 85 >emb|CAN75464.1| hypothetical protein VITISV_006518 [Vitis vinifera] Length = 504 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +3 Query: 207 LSSALQHYIQSDFPSQDQKINAHILKIGFKPNTNISMKLLV 329 LS ALQHYI SDFPS QKI++HILKIGF+PNTN+S+KLL+ Sbjct: 45 LSVALQHYINSDFPSHGQKIHSHILKIGFEPNTNVSIKLLI 85 >ref|XP_002305756.1| hypothetical protein POPTR_0004s05320g [Populus trichocarpa] gi|222848720|gb|EEE86267.1| hypothetical protein POPTR_0004s05320g [Populus trichocarpa] Length = 530 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/66 (50%), Positives = 41/66 (62%), Gaps = 13/66 (19%) Frame = +3 Query: 171 YTNIFPTQILP-------------LLSSALQHYIQSDFPSQDQKINAHILKIGFKPNTNI 311 YT++ P+ + P LSSALQHYI SD P QKI+ HILK GF+PN NI Sbjct: 20 YTSLRPSNVFPPNQEDYITHQTPTTLSSALQHYINSDTPFHGQKIHTHILKTGFRPNINI 79 Query: 312 SMKLLV 329 S+KLL+ Sbjct: 80 SIKLLI 85 >ref|XP_004163477.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Cucumis sativus] Length = 523 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +3 Query: 207 LSSALQHYIQSDFPSQDQKINAHILKIGFKPNTNISMKLLV 329 LSSALQHYI SD PS KI+AHILK GF PNTNIS+KLL+ Sbjct: 37 LSSALQHYINSDDPSHGLKIHAHILKTGFIPNTNISIKLLI 77 >ref|XP_004149063.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Cucumis sativus] Length = 523 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +3 Query: 207 LSSALQHYIQSDFPSQDQKINAHILKIGFKPNTNISMKLLV 329 LSSALQHYI SD PS KI+AHILK GF PNTNIS+KLL+ Sbjct: 37 LSSALQHYINSDDPSHGLKIHAHILKTGFIPNTNISIKLLI 77 >gb|EXB59940.1| hypothetical protein L484_013060 [Morus notabilis] Length = 550 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 207 LSSALQHYIQSDFPSQDQKINAHILKIGFKPNTNISMKLLV 329 +SS+LQHYI SD PS QKI+ H+LK GF PN NIS+KLL+ Sbjct: 39 ISSSLQHYINSDNPSNGQKIHTHVLKYGFNPNLNISIKLLI 79 >ref|XP_004485875.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Cicer arietinum] Length = 525 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +3 Query: 207 LSSALQHYIQSDFPSQDQKINAHILKIGFKPNTNISMKLLV 329 LS+ LQHYI S PS QKI++HILK GF PNTNIS+KLL+ Sbjct: 39 LSNTLQHYIYSQTPSHGQKIHSHILKTGFVPNTNISIKLLI 79 >ref|XP_007212512.1| hypothetical protein PRUPE_ppa017842mg [Prunus persica] gi|462408377|gb|EMJ13711.1| hypothetical protein PRUPE_ppa017842mg [Prunus persica] Length = 527 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +3 Query: 195 ILPLLSSALQHYIQSDFPSQDQKINAHILKIGFKPNTNISMKLLV 329 I L+S+LQHYI S+ PS QKI+ HILK GF+PN N+S+KLL+ Sbjct: 39 IATTLASSLQHYINSENPSHGQKIHTHILKTGFRPNINVSIKLLI 83 >ref|XP_007025441.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508780807|gb|EOY28063.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 532 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +3 Query: 207 LSSALQHYIQSDFPSQDQKINAHILKIGFKPNTNISMKLLV 329 LS+ALQH+I SD P QKI+ HI+K GF PNTN+S+KLL+ Sbjct: 46 LSAALQHFINSDTPFHGQKIHTHIIKSGFSPNTNVSIKLLI 86 >ref|XP_007148069.1| hypothetical protein PHAVU_006G178000g [Phaseolus vulgaris] gi|561021292|gb|ESW20063.1| hypothetical protein PHAVU_006G178000g [Phaseolus vulgaris] Length = 497 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +3 Query: 204 LLSSALQHYIQSDFPSQDQKINAHILKIGFKPNTNISMKLLV 329 LLS+ALQHYI S P+ QKI++ ILK GF PNTNIS+KLL+ Sbjct: 38 LLSTALQHYINSQTPTHGQKIHSRILKSGFVPNTNISIKLLI 79 >ref|XP_003593731.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355482779|gb|AES63982.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 520 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +3 Query: 210 SSALQHYIQSDFPSQDQKINAHILKIGFKPNTNISMKLLV 329 S+ LQHYI S PS QKI++HILK GF PNTNIS+KLL+ Sbjct: 41 SNTLQHYINSQTPSHGQKIHSHILKTGFVPNTNISIKLLI 80 >ref|XP_006449472.1| hypothetical protein CICLE_v10014987mg [Citrus clementina] gi|557552083|gb|ESR62712.1| hypothetical protein CICLE_v10014987mg [Citrus clementina] Length = 499 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +3 Query: 207 LSSALQHYIQSDFPSQDQKINAHILKIGFKPNTNISMKLLV 329 L SALQHYI SD P KI+AHI K G KPNTNIS+KLL+ Sbjct: 48 LPSALQHYINSDTPFHGLKIHAHITKTGVKPNTNISIKLLI 88 >ref|XP_004301518.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 525 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = +3 Query: 204 LLSSALQHYIQSDFPSQDQKINAHILKIGFKPNTNISMKLLV 329 +LSSALQ YI S+ P QKI+AHILK GF+PN N+S+KLL+ Sbjct: 39 VLSSALQSYINSENPYPGQKIHAHILKSGFRPNNNVSIKLLI 80 >ref|XP_006467676.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like isoform X2 [Citrus sinensis] Length = 499 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +3 Query: 207 LSSALQHYIQSDFPSQDQKINAHILKIGFKPNTNISMKLLV 329 L SALQHYI SD P KI+AHI K G KPNTNIS+KLL+ Sbjct: 48 LPSALQHYINSDTPFYGLKIHAHITKTGVKPNTNISIKLLI 88 >ref|XP_006467675.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like isoform X1 [Citrus sinensis] Length = 534 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +3 Query: 207 LSSALQHYIQSDFPSQDQKINAHILKIGFKPNTNISMKLLV 329 L SALQHYI SD P KI+AHI K G KPNTNIS+KLL+ Sbjct: 48 LPSALQHYINSDTPFYGLKIHAHITKTGVKPNTNISIKLLI 88