BLASTX nr result
ID: Sinomenium21_contig00043348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00043348 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC33628.1| Protein brittle-1 [Morus notabilis] 60 3e-07 ref|XP_002513312.1| Mitochondrial deoxynucleotide carrier, putat... 58 1e-06 ref|XP_002311894.1| mitochondrial substrate carrier family prote... 58 1e-06 ref|XP_006379389.1| hypothetical protein POPTR_0008s00470g [Popu... 58 1e-06 ref|XP_007023658.1| Mitochondrial substrate carrier family prote... 58 2e-06 ref|XP_007023657.1| Mitochondrial substrate carrier family prote... 58 2e-06 ref|XP_007023656.1| Mitochondrial substrate carrier family prote... 58 2e-06 ref|XP_002316432.1| mitochondrial substrate carrier family prote... 58 2e-06 ref|XP_004303803.1| PREDICTED: probable mitochondrial adenine nu... 57 3e-06 ref|XP_006661390.1| PREDICTED: probable mitochondrial adenine nu... 57 3e-06 ref|XP_004957243.1| PREDICTED: probable mitochondrial adenine nu... 56 6e-06 ref|XP_004507571.1| PREDICTED: probable mitochondrial adenine nu... 56 6e-06 ref|XP_004507569.1| PREDICTED: probable mitochondrial adenine nu... 56 6e-06 ref|XP_003578358.1| PREDICTED: protein brittle-1, chloroplastic/... 55 8e-06 >gb|EXC33628.1| Protein brittle-1 [Morus notabilis] Length = 423 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 1 ASSLKVMPSSGITWMFYEAWKDILLFDKHIL 93 AS LKVMPSSGITWMFYEAWKDILLF +H L Sbjct: 393 ASCLKVMPSSGITWMFYEAWKDILLFQRHPL 423 >ref|XP_002513312.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis] gi|223547220|gb|EEF48715.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis] Length = 375 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 ASSLKVMPSSGITWMFYEAWKDILLFDKHIL 93 AS LKVMPSSGITWMFYEAWKDILL +K +L Sbjct: 345 ASCLKVMPSSGITWMFYEAWKDILLVEKRLL 375 >ref|XP_002311894.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|222851714|gb|EEE89261.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 342 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 ASSLKVMPSSGITWMFYEAWKDILLFDKHIL 93 AS LKVMPSSGITWMFYEAWKDILL +K +L Sbjct: 312 ASCLKVMPSSGITWMFYEAWKDILLVEKRLL 342 >ref|XP_006379389.1| hypothetical protein POPTR_0008s00470g [Populus trichocarpa] gi|118488459|gb|ABK96044.1| unknown [Populus trichocarpa] gi|550332072|gb|ERP57186.1| hypothetical protein POPTR_0008s00470g [Populus trichocarpa] Length = 365 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 ASSLKVMPSSGITWMFYEAWKDILLFDKHIL 93 AS LKVMPSSGITWMFYEAWKDILL +K +L Sbjct: 335 ASCLKVMPSSGITWMFYEAWKDILLVEKRLL 365 >ref|XP_007023658.1| Mitochondrial substrate carrier family protein isoform 3 [Theobroma cacao] gi|508779024|gb|EOY26280.1| Mitochondrial substrate carrier family protein isoform 3 [Theobroma cacao] Length = 295 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 ASSLKVMPSSGITWMFYEAWKDILLFDKHIL 93 AS LKVMPSSGITWMFYEAWKDILL +K +L Sbjct: 265 ASCLKVMPSSGITWMFYEAWKDILLVEKRML 295 >ref|XP_007023657.1| Mitochondrial substrate carrier family protein isoform 2 [Theobroma cacao] gi|508779023|gb|EOY26279.1| Mitochondrial substrate carrier family protein isoform 2 [Theobroma cacao] Length = 343 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 ASSLKVMPSSGITWMFYEAWKDILLFDKHIL 93 AS LKVMPSSGITWMFYEAWKDILL +K +L Sbjct: 313 ASCLKVMPSSGITWMFYEAWKDILLVEKRML 343 >ref|XP_007023656.1| Mitochondrial substrate carrier family protein isoform 1 [Theobroma cacao] gi|508779022|gb|EOY26278.1| Mitochondrial substrate carrier family protein isoform 1 [Theobroma cacao] Length = 362 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 ASSLKVMPSSGITWMFYEAWKDILLFDKHIL 93 AS LKVMPSSGITWMFYEAWKDILL +K +L Sbjct: 332 ASCLKVMPSSGITWMFYEAWKDILLVEKRML 362 >ref|XP_002316432.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|222865472|gb|EEF02603.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 338 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 1 ASSLKVMPSSGITWMFYEAWKDILLFDKHIL 93 AS LKVMPSSGITWMFYEAWKD+LL +K +L Sbjct: 308 ASCLKVMPSSGITWMFYEAWKDVLLVEKQLL 338 >ref|XP_004303803.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL1-like [Fragaria vesca subsp. vesca] Length = 369 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 1 ASSLKVMPSSGITWMFYEAWKDILLFDKH 87 AS LKVMPSSGITWMFYEAWKDILL +H Sbjct: 338 ASCLKVMPSSGITWMFYEAWKDILLVQRH 366 >ref|XP_006661390.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL1-like [Oryza brachyantha] Length = 367 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 ASSLKVMPSSGITWMFYEAWKDILLFDKH 87 AS LKVMP+SGITWMFYEAWKDILL DK+ Sbjct: 335 ASCLKVMPNSGITWMFYEAWKDILLSDKY 363 >ref|XP_004957243.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL1-like [Setaria italica] Length = 378 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 1 ASSLKVMPSSGITWMFYEAWKDILLFDK 84 AS LKVMP+SGITWMFYEAWKDILL DK Sbjct: 344 ASCLKVMPNSGITWMFYEAWKDILLADK 371 >ref|XP_004507571.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL1-like isoform X3 [Cicer arietinum] Length = 328 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 ASSLKVMPSSGITWMFYEAWKDILLFDKHIL 93 AS LKVMPSSGITWMFYEAWKDILL K ++ Sbjct: 298 ASCLKVMPSSGITWMFYEAWKDILLVQKGLI 328 >ref|XP_004507569.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL1-like isoform X1 [Cicer arietinum] gi|502149543|ref|XP_004507570.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL1-like isoform X2 [Cicer arietinum] Length = 368 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 1 ASSLKVMPSSGITWMFYEAWKDILLFDKHIL 93 AS LKVMPSSGITWMFYEAWKDILL K ++ Sbjct: 338 ASCLKVMPSSGITWMFYEAWKDILLVQKGLI 368 >ref|XP_003578358.1| PREDICTED: protein brittle-1, chloroplastic/amyloplastic-like [Brachypodium distachyon] Length = 378 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +1 Query: 1 ASSLKVMPSSGITWMFYEAWKDILLFDK 84 AS LKVMP+SGITWMFYEAWKDILL DK Sbjct: 346 ASCLKVMPNSGITWMFYEAWKDILLDDK 373