BLASTX nr result
ID: Sinomenium21_contig00043326
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00043326 (391 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW47272.1| ribosomal protein S4 [Laurus nobilis] 58 1e-06 >gb|AAW47272.1| ribosomal protein S4 [Laurus nobilis] Length = 311 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -1 Query: 238 LCSTNYLKVSHGDIISFQENYARTCGEVIRRSFSCNLEL 122 + S +LKVSHGD+ISFQENYARTCGE IRRSF ++ + Sbjct: 117 MVSITHLKVSHGDLISFQENYARTCGEEIRRSFYIDISV 155