BLASTX nr result
ID: Sinomenium21_contig00043218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00043218 (564 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW73339.1| hypothetical protein ZEAMMB73_651851 [Zea mays] 58 2e-06 >gb|AFW73339.1| hypothetical protein ZEAMMB73_651851 [Zea mays] Length = 114 Score = 57.8 bits (138), Expect = 2e-06 Identities = 40/96 (41%), Positives = 49/96 (51%), Gaps = 3/96 (3%) Frame = +2 Query: 110 PGLPTLSTRCQPIKNYSNYNEDDDDRAIGE---KARSTAEEFSWVAKEKAEAVKRSKTAY 280 P LP L P Y + + DDD +GE KARSTAEEF VAKEK + V Sbjct: 22 PALPVLCNNVLPDHRYYSAEKHDDDTTLGEIGDKARSTAEEFLRVAKEKTDDVAEG-AKE 80 Query: 281 AAFEGLTATPGESDYEVAKQKLKETVEKGAHENKGK 388 E A GESD E K+K K VE+G + ++ K Sbjct: 81 TLHETKEAVVGESDDE--KEKFKRRVEEGKYHHQKK 114