BLASTX nr result
ID: Sinomenium21_contig00043137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00043137 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588318.1| hypothetical protein MTR_1g005920 [Medicago ... 69 9e-10 ref|XP_003597210.1| Fasciclin-like arabinogalactan protein [Medi... 62 2e-09 ref|XP_003588396.1| hypothetical protein MTR_1g006790 [Medicago ... 67 2e-09 ref|XP_003588294.1| hypothetical protein MTR_1g005480 [Medicago ... 64 2e-08 ref|XP_003591560.1| hypothetical protein MTR_1g088800 [Medicago ... 58 6e-07 >ref|XP_003588318.1| hypothetical protein MTR_1g005920 [Medicago truncatula] gi|355477366|gb|AES58569.1| hypothetical protein MTR_1g005920 [Medicago truncatula] Length = 178 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = +1 Query: 145 DSDLPGDSSLARGFESKHGHLQLRGSSRSSIEEPGQSTS 261 DSDL GDSSLAR FESKHGHLQLRG+SRSSIEEPG+ S Sbjct: 3 DSDLTGDSSLARAFESKHGHLQLRGNSRSSIEEPGRVNS 41 >ref|XP_003597210.1| Fasciclin-like arabinogalactan protein [Medicago truncatula] gi|355486258|gb|AES67461.1| Fasciclin-like arabinogalactan protein [Medicago truncatula] Length = 335 Score = 62.4 bits (150), Expect(2) = 2e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 106 PSQQRRPSYCKVRLCPSPRTHSGSEEQLVQLLEQP 2 PS + P+YCKVRLCPSPR HSGSEE LVQLLEQP Sbjct: 299 PSNEDLPTYCKVRLCPSPRIHSGSEELLVQLLEQP 333 Score = 25.4 bits (54), Expect(2) = 2e-09 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = -3 Query: 108 TRPSNEDLPT 79 TRPSNEDLPT Sbjct: 297 TRPSNEDLPT 306 >ref|XP_003588396.1| hypothetical protein MTR_1g006790 [Medicago truncatula] gi|355477444|gb|AES58647.1| hypothetical protein MTR_1g006790 [Medicago truncatula] Length = 179 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +1 Query: 145 DSDLPGDSSLARGFESKHGHLQLRGSSRSSIEEPG 249 DSDL GDSSLAR FESKHGHLQLRG+SRSSIEEPG Sbjct: 3 DSDLTGDSSLARAFESKHGHLQLRGNSRSSIEEPG 37 >ref|XP_003588294.1| hypothetical protein MTR_1g005480 [Medicago truncatula] gi|355477342|gb|AES58545.1| hypothetical protein MTR_1g005480 [Medicago truncatula] Length = 179 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +1 Query: 145 DSDLPGDSSLARGFESKHGHLQLRGSSRSSIEEPG 249 DSDL DSSLAR FESKHGHLQLRG+SRSSIEEPG Sbjct: 3 DSDLTRDSSLARAFESKHGHLQLRGNSRSSIEEPG 37 >ref|XP_003591560.1| hypothetical protein MTR_1g088800 [Medicago truncatula] gi|355480608|gb|AES61811.1| hypothetical protein MTR_1g088800 [Medicago truncatula] Length = 218 Score = 57.8 bits (138), Expect(2) = 6e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 163 DSSLARGFESKHGHLQLRGSSRSSIEEPG 249 DSSLAR FESKHGHLQLRG+SRSSIEEPG Sbjct: 48 DSSLARAFESKHGHLQLRGNSRSSIEEPG 76 Score = 21.2 bits (43), Expect(2) = 6e-07 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 132 RRNSRLRSSW 161 RRN RLRS W Sbjct: 38 RRNERLRSYW 47