BLASTX nr result
ID: Sinomenium21_contig00042657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00042657 (447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006603841.1| PREDICTED: paired amphipathic helix protein ... 59 5e-07 ref|XP_006603840.1| PREDICTED: paired amphipathic helix protein ... 59 5e-07 ref|XP_006593647.1| PREDICTED: paired amphipathic helix protein ... 59 5e-07 ref|XP_006593646.1| PREDICTED: paired amphipathic helix protein ... 59 5e-07 ref|XP_006593645.1| PREDICTED: paired amphipathic helix protein ... 59 5e-07 ref|XP_007151160.1| hypothetical protein PHAVU_004G022900g [Phas... 59 5e-07 ref|XP_007151159.1| hypothetical protein PHAVU_004G022900g [Phas... 59 5e-07 ref|XP_003543838.1| PREDICTED: paired amphipathic helix protein ... 59 5e-07 ref|XP_006408489.1| hypothetical protein EUTSA_v10019899mg [Eutr... 59 7e-07 ref|XP_002267856.2| PREDICTED: paired amphipathic helix protein ... 58 1e-06 emb|CBI32068.3| unnamed protein product [Vitis vinifera] 58 1e-06 gb|ABF70137.1| transcriptional repressor protein-related [Musa b... 58 1e-06 gb|ABF70056.1| paired amphipathic helix repeat-containing protei... 58 1e-06 ref|XP_004489351.1| PREDICTED: paired amphipathic helix protein ... 58 2e-06 ref|XP_004173504.1| PREDICTED: paired amphipathic helix protein ... 57 2e-06 ref|XP_004143788.1| PREDICTED: paired amphipathic helix protein ... 57 2e-06 ref|XP_002884284.1| hypothetical protein ARALYDRAFT_477381 [Arab... 57 3e-06 ref|XP_003618393.1| Paired amphipathic helix protein Sin3 [Medic... 57 3e-06 gb|EXB74740.1| Paired amphipathic helix protein Sin3-like 4 [Mor... 56 4e-06 ref|XP_006645435.1| PREDICTED: paired amphipathic helix protein ... 56 4e-06 >ref|XP_006603841.1| PREDICTED: paired amphipathic helix protein Sin3-like 2-like isoform X2 [Glycine max] Length = 1401 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD+ID L KN T +LP+IL LKQK+EEW S+ + A++Y + KSLDHR+ Sbjct: 602 GLDVIDILRKNPTHALPVILTRLKQKQEEWSKCRSDFNKVWAEIYAKNHYKSLDHRS 658 >ref|XP_006603840.1| PREDICTED: paired amphipathic helix protein Sin3-like 2-like isoform X1 [Glycine max] Length = 1402 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD+ID L KN T +LP+IL LKQK+EEW S+ + A++Y + KSLDHR+ Sbjct: 603 GLDVIDILRKNPTHALPVILTRLKQKQEEWSKCRSDFNKVWAEIYAKNHYKSLDHRS 659 >ref|XP_006593647.1| PREDICTED: paired amphipathic helix protein Sin3-like 2-like isoform X4 [Glycine max] Length = 1372 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD+ID L KN T +LP+IL LKQK+EEW S+ + A++Y + KSLDHR+ Sbjct: 579 GLDVIDILRKNPTHALPVILTRLKQKQEEWSKCRSDFNKVWAEIYAKNHYKSLDHRS 635 >ref|XP_006593646.1| PREDICTED: paired amphipathic helix protein Sin3-like 2-like isoform X3 [Glycine max] Length = 1373 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD+ID L KN T +LP+IL LKQK+EEW S+ + A++Y + KSLDHR+ Sbjct: 580 GLDVIDILRKNPTHALPVILTRLKQKQEEWSKCRSDFNKVWAEIYAKNHYKSLDHRS 636 >ref|XP_006593645.1| PREDICTED: paired amphipathic helix protein Sin3-like 2-like isoform X2 [Glycine max] Length = 1374 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD+ID L KN T +LP+IL LKQK+EEW S+ + A++Y + KSLDHR+ Sbjct: 581 GLDVIDILRKNPTHALPVILTRLKQKQEEWSKCRSDFNKVWAEIYAKNHYKSLDHRS 637 >ref|XP_007151160.1| hypothetical protein PHAVU_004G022900g [Phaseolus vulgaris] gi|561024469|gb|ESW23154.1| hypothetical protein PHAVU_004G022900g [Phaseolus vulgaris] Length = 1392 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD+ID L KN T +LP+IL LKQK+EEW S+ + A++Y + KSLDHR+ Sbjct: 598 GLDVIDILRKNPTHALPVILTRLKQKQEEWSRCRSDFNKVWAEIYAKNHYKSLDHRS 654 >ref|XP_007151159.1| hypothetical protein PHAVU_004G022900g [Phaseolus vulgaris] gi|561024468|gb|ESW23153.1| hypothetical protein PHAVU_004G022900g [Phaseolus vulgaris] Length = 1391 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD+ID L KN T +LP+IL LKQK+EEW S+ + A++Y + KSLDHR+ Sbjct: 597 GLDVIDILRKNPTHALPVILTRLKQKQEEWSRCRSDFNKVWAEIYAKNHYKSLDHRS 653 >ref|XP_003543838.1| PREDICTED: paired amphipathic helix protein Sin3-like 2-like isoform X1 [Glycine max] Length = 1371 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD+ID L KN T +LP+IL LKQK+EEW S+ + A++Y + KSLDHR+ Sbjct: 578 GLDVIDILRKNPTHALPVILTRLKQKQEEWSKCRSDFNKVWAEIYAKNHYKSLDHRS 634 >ref|XP_006408489.1| hypothetical protein EUTSA_v10019899mg [Eutrema salsugineum] gi|557109635|gb|ESQ49942.1| hypothetical protein EUTSA_v10019899mg [Eutrema salsugineum] Length = 1376 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/57 (50%), Positives = 38/57 (66%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD+ID LHKN +LP+IL LKQK++EW + + AKVY + KSLDHR+ Sbjct: 595 GLDVIDVLHKNPATALPVILTRLKQKQDEWKKCREDFDKVWAKVYAKNHYKSLDHRS 651 >ref|XP_002267856.2| PREDICTED: paired amphipathic helix protein Sin3-like 4-like [Vitis vinifera] Length = 1421 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD++D L KN T +LP+IL LKQK+EEW S+ + A++Y + KSLDHR+ Sbjct: 601 GLDVMDVLRKNATLALPVILTRLKQKQEEWARCRSDFNKVWAEIYAKNYHKSLDHRS 657 >emb|CBI32068.3| unnamed protein product [Vitis vinifera] Length = 1445 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD++D L KN T +LP+IL LKQK+EEW S+ + A++Y + KSLDHR+ Sbjct: 619 GLDVMDVLRKNATLALPVILTRLKQKQEEWARCRSDFNKVWAEIYAKNYHKSLDHRS 675 >gb|ABF70137.1| transcriptional repressor protein-related [Musa balbisiana] Length = 1364 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD++D L KN + SLP+IL LKQK+EEW S+ + A++Y + KSLDHR+ Sbjct: 550 GLDVMDVLRKNSSLSLPVILTRLKQKQEEWTRCRSDFNKVWAEIYARNYHKSLDHRS 606 >gb|ABF70056.1| paired amphipathic helix repeat-containing protein / transcription regulator-related [Musa acuminata] Length = 1408 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD++D L KN + SLP+IL LKQK+EEW S+ + A++Y + KSLDHR+ Sbjct: 582 GLDVMDVLRKNSSLSLPVILTRLKQKQEEWTRCRSDFNKVWAEIYAKNYHKSLDHRS 638 >ref|XP_004489351.1| PREDICTED: paired amphipathic helix protein Sin3-like 2-like [Cicer arietinum] Length = 1407 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD +D L KN T +LP+IL LKQK+EEW S+ + A++Y + KSLDHR+ Sbjct: 600 GLDALDILRKNPTHALPVILTRLKQKQEEWSRCRSDFNKVWAEIYAKNHYKSLDHRS 656 >ref|XP_004173504.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like, partial [Cucumis sativus] Length = 563 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD++D L KN SLP+IL LKQK+EEW S+ + A++Y + +KSLDHR+ Sbjct: 279 GLDVMDVLRKNAPLSLPVILTRLKQKQEEWARCRSDFNKVWAEIYFKNYQKSLDHRS 335 >ref|XP_004143788.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like [Cucumis sativus] Length = 1394 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD++D L KN SLP+IL LKQK+EEW S+ + A++Y + +KSLDHR+ Sbjct: 601 GLDVMDVLRKNAPLSLPVILTRLKQKQEEWARCRSDFNKVWAEIYFKNYQKSLDHRS 657 >ref|XP_002884284.1| hypothetical protein ARALYDRAFT_477381 [Arabidopsis lyrata subsp. lyrata] gi|297330124|gb|EFH60543.1| hypothetical protein ARALYDRAFT_477381 [Arabidopsis lyrata subsp. lyrata] Length = 1378 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/57 (50%), Positives = 37/57 (64%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD+ID LHKN +LP+IL LKQK++EW E + A VY + KSLDHR+ Sbjct: 585 GLDVIDILHKNLATALPVILTRLKQKQDEWKKCREEFDKVWANVYAKNHYKSLDHRS 641 >ref|XP_003618393.1| Paired amphipathic helix protein Sin3 [Medicago truncatula] gi|355493408|gb|AES74611.1| Paired amphipathic helix protein Sin3 [Medicago truncatula] Length = 1404 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD++D L KN T +LP+IL LKQK+EEW S+ + A +Y + KSLDHR+ Sbjct: 610 GLDVLDILRKNPTHALPVILTRLKQKQEEWNRCRSDFNKVWADIYSKNHYKSLDHRS 666 >gb|EXB74740.1| Paired amphipathic helix protein Sin3-like 4 [Morus notabilis] Length = 1411 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/57 (47%), Positives = 39/57 (68%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD++D L KN T +LP+IL LKQK+EEW ++ + A++Y + KSLDHR+ Sbjct: 628 GLDVMDVLRKNATLALPVILTRLKQKQEEWARCRADFNKVWAEIYSKNYHKSLDHRS 684 >ref|XP_006645435.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like [Oryza brachyantha] Length = 1446 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/57 (47%), Positives = 39/57 (68%) Frame = +1 Query: 1 GLDMIDQLHKNETRSLPIILQHLKQKREEWFWFCSEMKEKLAKVYVND*KKSLDHRN 171 GLD++D L KN + +LP+IL LKQK+EEW S+ + A++Y + KSLDHR+ Sbjct: 629 GLDVMDVLRKNASVALPVILTRLKQKQEEWSRCRSDFNKVWAEIYAKNYHKSLDHRS 685