BLASTX nr result
ID: Sinomenium21_contig00042499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00042499 (751 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006841537.1| hypothetical protein AMTR_s00003p00162280 [A... 59 2e-06 >ref|XP_006841537.1| hypothetical protein AMTR_s00003p00162280 [Amborella trichopoda] gi|548843558|gb|ERN03212.1| hypothetical protein AMTR_s00003p00162280 [Amborella trichopoda] Length = 96 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/51 (54%), Positives = 38/51 (74%) Frame = +3 Query: 264 SNYNYYEKRQVFLRSYKFSRKRGFLERMRRCLLSSVRLKRIIWLGLRCARK 416 S++ Y+EKRQ+FLRSY+F RKRG ER++ CL VR+KR +W R AR+ Sbjct: 15 SDHCYFEKRQLFLRSYQFCRKRGLAERIKGCL---VRVKRAVWFKFRKARR 62