BLASTX nr result
ID: Sinomenium21_contig00042382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00042382 (403 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007226092.1| hypothetical protein PRUPE_ppa010814mg [Prun... 58 1e-06 ref|XP_006845609.1| hypothetical protein AMTR_s00019p00209010 [A... 57 3e-06 ref|XP_001765451.1| predicted protein [Physcomitrella patens] gi... 57 3e-06 gb|EMS52832.1| 39S ribosomal protein L28, mitochondrial [Triticu... 57 3e-06 ref|XP_006657801.1| PREDICTED: 54S ribosomal protein L24, mitoch... 56 4e-06 ref|NP_001059912.1| Os07g0544900 [Oryza sativa Japonica Group] g... 56 4e-06 ref|XP_002273919.1| PREDICTED: 60S ribosomal protein L24, mitoch... 56 4e-06 emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera] 56 4e-06 ref|XP_007011601.1| Ribosomal L28 family, putative [Theobroma ca... 55 1e-05 >ref|XP_007226092.1| hypothetical protein PRUPE_ppa010814mg [Prunus persica] gi|462423028|gb|EMJ27291.1| hypothetical protein PRUPE_ppa010814mg [Prunus persica] Length = 235 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +1 Query: 1 GRAKRGIYAGRHIQFGNQISEDGGNK 78 GRAKRGIYAGRHIQFGNQISEDGGNK Sbjct: 61 GRAKRGIYAGRHIQFGNQISEDGGNK 86 >ref|XP_006845609.1| hypothetical protein AMTR_s00019p00209010 [Amborella trichopoda] gi|548848181|gb|ERN07284.1| hypothetical protein AMTR_s00019p00209010 [Amborella trichopoda] Length = 223 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 GRAKRGIYAGRHIQFGNQISEDGGNK 78 GRAKRG+YAGRHIQFGNQ+SEDGGNK Sbjct: 41 GRAKRGLYAGRHIQFGNQVSEDGGNK 66 >ref|XP_001765451.1| predicted protein [Physcomitrella patens] gi|162683301|gb|EDQ69712.1| predicted protein [Physcomitrella patens] Length = 108 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 GRAKRGIYAGRHIQFGNQISEDGGNK 78 GRAKRG+YAGRHIQFGNQ+SEDGGNK Sbjct: 6 GRAKRGLYAGRHIQFGNQVSEDGGNK 31 >gb|EMS52832.1| 39S ribosomal protein L28, mitochondrial [Triticum urartu] Length = 309 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 GRAKRGIYAGRHIQFGNQISEDGGNK*SSLIL 96 GRAKRGI+AGRHIQFGN++SEDGGNK L+L Sbjct: 42 GRAKRGIFAGRHIQFGNKVSEDGGNKGRRLVL 73 >ref|XP_006657801.1| PREDICTED: 54S ribosomal protein L24, mitochondrial-like isoform X1 [Oryza brachyantha] gi|573951031|ref|XP_006657802.1| PREDICTED: 54S ribosomal protein L24, mitochondrial-like isoform X2 [Oryza brachyantha] Length = 204 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 GRAKRGIYAGRHIQFGNQISEDGGNK 78 GRAKRGIYAGRHIQFGN++SEDGGNK Sbjct: 42 GRAKRGIYAGRHIQFGNKVSEDGGNK 67 >ref|NP_001059912.1| Os07g0544900 [Oryza sativa Japonica Group] gi|34393259|dbj|BAC83129.1| unknown protein [Oryza sativa Japonica Group] gi|113611448|dbj|BAF21826.1| Os07g0544900 [Oryza sativa Japonica Group] gi|125558698|gb|EAZ04234.1| hypothetical protein OsI_26378 [Oryza sativa Indica Group] gi|125600612|gb|EAZ40188.1| hypothetical protein OsJ_24633 [Oryza sativa Japonica Group] Length = 204 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 GRAKRGIYAGRHIQFGNQISEDGGNK 78 GRAKRGIYAGRHIQFGN++SEDGGNK Sbjct: 42 GRAKRGIYAGRHIQFGNKVSEDGGNK 67 >ref|XP_002273919.1| PREDICTED: 60S ribosomal protein L24, mitochondrial [Vitis vinifera] gi|302142683|emb|CBI19886.3| unnamed protein product [Vitis vinifera] Length = 216 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 GRAKRGIYAGRHIQFGNQISEDGGNK 78 GRAKRGIYAGRHIQFGN++SEDGGNK Sbjct: 37 GRAKRGIYAGRHIQFGNRVSEDGGNK 62 >emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera] Length = 1084 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +1 Query: 1 GRAKRGIYAGRHIQFGNQISEDGGNK 78 GRAKRGIYAGRHIQFGN++SEDGGNK Sbjct: 37 GRAKRGIYAGRHIQFGNRVSEDGGNK 62 >ref|XP_007011601.1| Ribosomal L28 family, putative [Theobroma cacao] gi|508781964|gb|EOY29220.1| Ribosomal L28 family, putative [Theobroma cacao] Length = 258 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +1 Query: 4 RAKRGIYAGRHIQFGNQISEDGGNK*SSLILCLNNCY 114 RAKRG+YAGRHIQFGN+ISEDGGNK L + C+ Sbjct: 42 RAKRGLYAGRHIQFGNRISEDGGNKYFFLFHSITPCF 78