BLASTX nr result
ID: Sinomenium21_contig00042320
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00042320 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203056.1| hypothetical protein PRUPE_ppa000079mg [Prun... 60 3e-07 >ref|XP_007203056.1| hypothetical protein PRUPE_ppa000079mg [Prunus persica] gi|462398587|gb|EMJ04255.1| hypothetical protein PRUPE_ppa000079mg [Prunus persica] Length = 1904 Score = 60.1 bits (144), Expect = 3e-07 Identities = 42/97 (43%), Positives = 52/97 (53%), Gaps = 6/97 (6%) Frame = -1 Query: 275 KKKHRDGLKPVKSSK-----TKRTSKDVLSEALPLQIEDEVPDFPXXXXXXXXXXXXXEI 111 KKK RD K KSSK K + SEA+ LQ+ED+VPDFP EI Sbjct: 11 KKKARDPPKFNKSSKKPFKPNKDRNDTARSEAVTLQLEDDVPDFPRGGGSALNRQERDEI 70 Query: 110 RAEVDAEFEAEQRDLXXXXXXXXXXNFM-AEEDLGSL 3 RAEVDAEFEAE+R++ + +E+D GSL Sbjct: 71 RAEVDAEFEAEEREMKKRKKIGMQKKSLSSEDDFGSL 107