BLASTX nr result
ID: Sinomenium21_contig00042306
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00042306 (390 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT33750.1| Putative chromatin-remodeling complex ATPase chai... 56 6e-06 >gb|EMT33750.1| Putative chromatin-remodeling complex ATPase chain [Aegilops tauschii] Length = 950 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (2%) Frame = -1 Query: 111 HLISQKSRGNSLLL-CKVRLRTIDPKWSDPSPGPCIRG 1 H ++ S GNSLLL C+ RLRTIDPKWSDPSP PC G Sbjct: 17 HEVTGSSPGNSLLLKCRERLRTIDPKWSDPSPDPCASG 54