BLASTX nr result
ID: Sinomenium21_contig00042114
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00042114 (614 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006368269.1| hypothetical protein POPTR_0001s01140g [Popu... 64 3e-08 ref|XP_007224417.1| hypothetical protein PRUPE_ppa021231mg, part... 63 8e-08 ref|XP_002316992.2| hypothetical protein POPTR_0011s14030g [Popu... 62 2e-07 ref|XP_006380187.1| hypothetical protein POPTR_0008s22720g [Popu... 60 7e-07 ref|XP_006380186.1| hypothetical protein POPTR_0008s22710g, part... 60 7e-07 ref|XP_006380075.1| hypothetical protein POPTR_0008s212101g, par... 60 7e-07 ref|XP_006380073.1| hypothetical protein POPTR_0008s21190g [Popu... 60 7e-07 ref|XP_002298144.2| hypothetical protein POPTR_0001s23150g [Popu... 59 1e-06 ref|XP_004303328.1| PREDICTED: F-box protein At3g07870-like [Fra... 58 2e-06 ref|XP_003621771.1| F-box family protein [Medicago truncatula] g... 58 2e-06 ref|XP_002520393.1| ubiquitin-protein ligase, putative [Ricinus ... 58 2e-06 ref|XP_004486105.1| PREDICTED: F-box/kelch-repeat protein At3g23... 57 3e-06 ref|XP_004243873.1| PREDICTED: F-box protein CPR30-like [Solanum... 57 3e-06 gb|EYU22882.1| hypothetical protein MIMGU_mgv1a018348mg [Mimulus... 57 6e-06 ref|XP_006352955.1| PREDICTED: F-box protein At3g07870-like [Sol... 57 6e-06 ref|XP_006437645.1| hypothetical protein CICLE_v10033438mg, part... 56 7e-06 ref|XP_007034258.1| Ubiquitin-protein ligase, putative [Theobrom... 56 9e-06 ref|XP_003531163.1| PREDICTED: F-box/kelch-repeat protein At3g06... 56 9e-06 ref|XP_003638382.1| Nuclear transcription factor Y subunit A-7, ... 56 9e-06 ref|XP_003594508.1| F-box family protein [Medicago truncatula] g... 56 9e-06 >ref|XP_006368269.1| hypothetical protein POPTR_0001s01140g [Populus trichocarpa] gi|550346173|gb|ERP64838.1| hypothetical protein POPTR_0001s01140g [Populus trichocarpa] Length = 477 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/50 (58%), Positives = 34/50 (68%) Frame = +2 Query: 410 RSISRLPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLHHNRA 559 RSIS LP++ +DILSRLP + +F C VCK W LI P F KLHH RA Sbjct: 30 RSISALPIQNLVDILSRLPFKTIFSCMCVCKKWKDLILAPEFAKLHHTRA 79 >ref|XP_007224417.1| hypothetical protein PRUPE_ppa021231mg, partial [Prunus persica] gi|462421353|gb|EMJ25616.1| hypothetical protein PRUPE_ppa021231mg, partial [Prunus persica] Length = 395 Score = 62.8 bits (151), Expect = 8e-08 Identities = 28/53 (52%), Positives = 39/53 (73%) Frame = +2 Query: 401 MRRRSISRLPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLHHNRA 559 M + +LP+ ITMDILSRL V+ +F CR VCK+WL +I+DP+F LH +R+ Sbjct: 14 MATQRFLQLPLGITMDILSRLSVKTLFNCRCVCKAWLSIISDPQFTHLHASRS 66 >ref|XP_002316992.2| hypothetical protein POPTR_0011s14030g [Populus trichocarpa] gi|550328360|gb|EEE97604.2| hypothetical protein POPTR_0011s14030g [Populus trichocarpa] Length = 433 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = +2 Query: 416 ISRLPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLHHNRA 559 ++ LP + +DILSRLP+R + C+SVCK+WLHL++DP F +LH R+ Sbjct: 36 VAELPNALIIDILSRLPIRPLLNCKSVCKTWLHLMSDPSFVRLHLERS 83 >ref|XP_006380187.1| hypothetical protein POPTR_0008s22720g [Populus trichocarpa] gi|550333708|gb|ERP57984.1| hypothetical protein POPTR_0008s22720g [Populus trichocarpa] Length = 451 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = +2 Query: 416 ISRLPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLHHNRA 559 +++LP + MDILSRLP++ + CR VCK+WLH I+D F KLH R+ Sbjct: 24 MNKLPSCLIMDILSRLPIKTILNCRCVCKTWLHYISDSFFAKLHLERS 71 >ref|XP_006380186.1| hypothetical protein POPTR_0008s22710g, partial [Populus trichocarpa] gi|550333707|gb|ERP57983.1| hypothetical protein POPTR_0008s22710g, partial [Populus trichocarpa] Length = 319 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = +2 Query: 416 ISRLPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLHHNRA 559 +++LP + MDILSRLP++ + CR VCK+WLH I+D F KLH R+ Sbjct: 25 MNKLPSCLIMDILSRLPIKTILNCRCVCKTWLHYISDSFFAKLHLERS 72 >ref|XP_006380075.1| hypothetical protein POPTR_0008s212101g, partial [Populus trichocarpa] gi|550333594|gb|ERP57872.1| hypothetical protein POPTR_0008s212101g, partial [Populus trichocarpa] Length = 215 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = +2 Query: 416 ISRLPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLHHNRA 559 +++LP + MDILSRLP++ + CR VCK+WLH I+D F KLH R+ Sbjct: 25 MNKLPSCLIMDILSRLPIKTILNCRCVCKTWLHYISDSFFAKLHLERS 72 >ref|XP_006380073.1| hypothetical protein POPTR_0008s21190g [Populus trichocarpa] gi|550333592|gb|ERP57870.1| hypothetical protein POPTR_0008s21190g [Populus trichocarpa] Length = 446 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = +2 Query: 416 ISRLPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLHHNRA 559 +++LP + MDILSRLP++ + CR VCK+WLH I+D F KLH R+ Sbjct: 1 MNKLPSCLIMDILSRLPIKTILNCRCVCKTWLHYISDSFFAKLHLERS 48 >ref|XP_002298144.2| hypothetical protein POPTR_0001s23150g [Populus trichocarpa] gi|550347962|gb|EEE82949.2| hypothetical protein POPTR_0001s23150g [Populus trichocarpa] Length = 370 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/64 (46%), Positives = 38/64 (59%) Frame = +2 Query: 413 SISRLPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLHHNRALKEADQSLSTF 592 S LP EI +DILSRLPV + QC+SVCKSW L++ P F +LH +A + S Sbjct: 20 STPTLPAEIFVDILSRLPVEAMTQCKSVCKSWRDLLSTPYFARLHFAKA-----KPSSLL 74 Query: 593 ILHC 604 HC Sbjct: 75 FCHC 78 >ref|XP_004303328.1| PREDICTED: F-box protein At3g07870-like [Fragaria vesca subsp. vesca] Length = 424 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/48 (47%), Positives = 34/48 (70%) Frame = +2 Query: 416 ISRLPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLHHNRA 559 + +LP + MDILSRLP++ + C+ VCK WLH+I+ P F +LH R+ Sbjct: 21 MEQLPQALVMDILSRLPIKSLCNCKYVCKEWLHMIHGPEFARLHLQRS 68 >ref|XP_003621771.1| F-box family protein [Medicago truncatula] gi|355496786|gb|AES77989.1| F-box family protein [Medicago truncatula] Length = 524 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/56 (46%), Positives = 40/56 (71%) Frame = +2 Query: 425 LPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLHHNRALKEADQSLSTF 592 LP E+ +ILSRLPVR + Q + VCKSW +I+DP+F K+H NR+ + + S+ ++ Sbjct: 94 LPDEVMAEILSRLPVRSLMQIKCVCKSWNTIISDPKFIKMHLNRSARNPNFSVVSY 149 >ref|XP_002520393.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223540440|gb|EEF42009.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 369 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = +2 Query: 422 RLPVEITMDILSRLPVRLVFQCRSVCKSWLHLI-NDPRFGKLHHNRALKEADQSLSTFIL 598 +LP EI +DILSRLPV+ + Q + VC++W +LI +DP F KLH R L+ + L +L Sbjct: 7 QLPFEIIIDILSRLPVKHLIQFKCVCRTWQYLISSDPEFAKLHLERVLQVTNVHLHRLLL 66 Query: 599 HCD 607 D Sbjct: 67 SAD 69 >ref|XP_004486105.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum] Length = 384 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/45 (53%), Positives = 34/45 (75%) Frame = +2 Query: 413 SISRLPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLH 547 S+ LP E+ ++ILSRLPV+ + Q + VCKSW LI+DP+F K+H Sbjct: 25 SLPTLPFELIIEILSRLPVKFLIQLQCVCKSWKSLISDPKFAKMH 69 >ref|XP_004243873.1| PREDICTED: F-box protein CPR30-like [Solanum lycopersicum] Length = 485 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/59 (40%), Positives = 38/59 (64%) Frame = +2 Query: 425 LPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLHHNRALKEADQSLSTFILH 601 LP ++ ++ILS+LP++ + QC +VCKSW +I +P F LHHN + A + F+ H Sbjct: 5 LPKDVLVEILSKLPLKTLVQCTTVCKSWYSIIINPNFISLHHNTHISTAGRRPLLFVRH 63 >gb|EYU22882.1| hypothetical protein MIMGU_mgv1a018348mg [Mimulus guttatus] Length = 386 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = +2 Query: 401 MRRRSISRLPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLH 547 M + + + LP EIT++ILSRLPVR V C+ VCKSWL L+ F K H Sbjct: 1 MNQETSTYLPPEITINILSRLPVRTVITCKLVCKSWLELLETQEFAKSH 49 >ref|XP_006352955.1| PREDICTED: F-box protein At3g07870-like [Solanum tuberosum] Length = 413 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/63 (42%), Positives = 36/63 (57%) Frame = +2 Query: 425 LPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLHHNRALKEADQSLSTFILHC 604 LP E+ ++I RLP + + QC SVCKSW LI P F +H N K+ D SL + HC Sbjct: 5 LPQEVLIEIFLRLPTKSLIQCTSVCKSWYSLITSPNFISIHLNNNNKDDDYSL---VRHC 61 Query: 605 DSQ 613 + Sbjct: 62 SEE 64 >ref|XP_006437645.1| hypothetical protein CICLE_v10033438mg, partial [Citrus clementina] gi|557539841|gb|ESR50885.1| hypothetical protein CICLE_v10033438mg, partial [Citrus clementina] Length = 372 Score = 56.2 bits (134), Expect = 7e-06 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = +2 Query: 425 LPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLHHNRA 559 LP EI +ILSRLPVR++ +C+SV K WL +I+DP F KLH ++ Sbjct: 11 LPSEIKFNILSRLPVRMLCRCKSVSKDWLQIISDPYFLKLHQEQS 55 >ref|XP_007034258.1| Ubiquitin-protein ligase, putative [Theobroma cacao] gi|508713287|gb|EOY05184.1| Ubiquitin-protein ligase, putative [Theobroma cacao] Length = 201 Score = 55.8 bits (133), Expect = 9e-06 Identities = 25/54 (46%), Positives = 40/54 (74%) Frame = +2 Query: 413 SISRLPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLHHNRALKEAD 574 +IS+LP +I +ILSRLPV+ + + + VCK W LI+DP+F KLH ++ K+++ Sbjct: 3 TISQLPHDIIANILSRLPVKCLLRSKCVCKPWRSLISDPQFAKLHLAQSQKDSN 56 >ref|XP_003531163.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Glycine max] Length = 363 Score = 55.8 bits (133), Expect = 9e-06 Identities = 27/53 (50%), Positives = 36/53 (67%) Frame = +2 Query: 425 LPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLHHNRALKEADQSL 583 LP ++ +IL RLPV+ + + +SVCKSWL LI+DPRF K H A AD+ L Sbjct: 3 LPQDLITEILLRLPVKSLVRFKSVCKSWLFLISDPRFAKSHFELAAALADRIL 55 >ref|XP_003638382.1| Nuclear transcription factor Y subunit A-7, partial [Medicago truncatula] gi|355504317|gb|AES85520.1| Nuclear transcription factor Y subunit A-7, partial [Medicago truncatula] Length = 455 Score = 55.8 bits (133), Expect = 9e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +2 Query: 413 SISRLPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLH 547 +I LP EI +ILSRLPV+ + Q +SVCKSW LI+DP+F K H Sbjct: 47 TIPTLPFEIVAEILSRLPVKYLMQLQSVCKSWKSLISDPKFIKKH 91 >ref|XP_003594508.1| F-box family protein [Medicago truncatula] gi|355483556|gb|AES64759.1| F-box family protein [Medicago truncatula] Length = 597 Score = 55.8 bits (133), Expect = 9e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +2 Query: 413 SISRLPVEITMDILSRLPVRLVFQCRSVCKSWLHLINDPRFGKLH 547 +I LP EI +ILSRLPV+ + Q +SVCKSW LI+DP+F K H Sbjct: 47 TIPTLPFEIVAEILSRLPVKYLMQLQSVCKSWKSLISDPKFIKKH 91