BLASTX nr result
ID: Sinomenium21_contig00041957
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00041957 (384 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006453474.1| hypothetical protein CICLE_v10008915mg [Citr... 57 3e-06 >ref|XP_006453474.1| hypothetical protein CICLE_v10008915mg [Citrus clementina] gi|568840313|ref|XP_006474114.1| PREDICTED: uncharacterized protein LOC102614433 [Citrus sinensis] gi|557556700|gb|ESR66714.1| hypothetical protein CICLE_v10008915mg [Citrus clementina] Length = 326 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/70 (45%), Positives = 43/70 (61%), Gaps = 10/70 (14%) Frame = +3 Query: 3 WGFERMMA--MDGQDFLMG-----VMG---KIGLVCLFGFVVVWSCVVNTAFYSDCKRLY 152 WG+E++MA MDG+DF G VMG K+GL+CL G VVWS VV T FY + ++ + Sbjct: 254 WGWEKLMAAMMDGEDFWKGNKWTVVMGSWEKVGLICLHGIEVVWSYVVTTVFYCEYRKRH 313 Query: 153 VERMEIQHSV 182 V E +V Sbjct: 314 VSTNENDSNV 323