BLASTX nr result
ID: Sinomenium21_contig00041813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00041813 (469 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266991.2| PREDICTED: protein BONZAI 3-like [Vitis vini... 69 7e-10 emb|CAN65570.1| hypothetical protein VITISV_025897 [Vitis vinifera] 69 7e-10 emb|CBI34303.3| unnamed protein product [Vitis vinifera] 69 9e-10 ref|XP_002266731.1| PREDICTED: protein BONZAI 3-like [Vitis vini... 69 9e-10 ref|XP_002268132.1| PREDICTED: protein BONZAI 3-like [Vitis vini... 68 1e-09 ref|XP_002265395.2| PREDICTED: protein BONZAI 3-like [Vitis vini... 67 2e-09 ref|XP_003633350.1| PREDICTED: protein BONZAI 3-like [Vitis vini... 67 2e-09 ref|XP_002267420.1| PREDICTED: protein BONZAI 3-like [Vitis vini... 67 2e-09 emb|CAN68494.1| hypothetical protein VITISV_022266 [Vitis vinifera] 67 2e-09 emb|CAN74634.1| hypothetical protein VITISV_032757 [Vitis vinifera] 67 2e-09 ref|XP_006341333.1| PREDICTED: protein BONZAI 3-like isoform X2 ... 65 7e-09 ref|XP_006341332.1| PREDICTED: protein BONZAI 3-like isoform X1 ... 65 7e-09 emb|CBI34312.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002512304.1| copine, putative [Ricinus communis] gi|22354... 64 2e-08 emb|CBI34306.3| unnamed protein product [Vitis vinifera] 64 3e-08 emb|CBI34309.3| unnamed protein product [Vitis vinifera] 63 5e-08 emb|CBI34308.3| unnamed protein product [Vitis vinifera] 63 5e-08 emb|CBI40680.3| unnamed protein product [Vitis vinifera] 63 5e-08 ref|XP_004248957.1| PREDICTED: protein BONZAI 3-like [Solanum ly... 62 6e-08 gb|EXB67641.1| Protein BONZAI 3 [Morus notabilis] 62 8e-08 >ref|XP_002266991.2| PREDICTED: protein BONZAI 3-like [Vitis vinifera] Length = 594 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = +2 Query: 2 FVPMREAHGAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLS 139 FVPMRE G Q S+VQALLQELPGQFL YMRSRDI P +VN Q S Sbjct: 543 FVPMREVRGGQTSVVQALLQELPGQFLTYMRSRDIKPSAVNIAQTS 588 >emb|CAN65570.1| hypothetical protein VITISV_025897 [Vitis vinifera] Length = 567 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/46 (73%), Positives = 36/46 (78%) Frame = +2 Query: 2 FVPMREAHGAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLS 139 FVPMRE G Q S+VQALLQELPGQFL YMRSRDI P +VN Q S Sbjct: 516 FVPMREVRGGQTSVVQALLQELPGQFLTYMRSRDIKPSAVNIAQTS 561 >emb|CBI34303.3| unnamed protein product [Vitis vinifera] Length = 551 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +2 Query: 2 FVPMREAHGAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLS 139 FVPMRE G Q S+VQALL+ELPGQFL YMRSRDI P++VN Q S Sbjct: 469 FVPMREVRGGQTSVVQALLEELPGQFLTYMRSRDIKPNAVNIAQTS 514 >ref|XP_002266731.1| PREDICTED: protein BONZAI 3-like [Vitis vinifera] Length = 594 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +2 Query: 2 FVPMREAHGAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLS 139 FVPMRE G Q S+VQALL+ELPGQFL YMRSRDI P++VN Q S Sbjct: 543 FVPMREVRGGQTSVVQALLEELPGQFLTYMRSRDIKPNAVNIAQTS 588 >ref|XP_002268132.1| PREDICTED: protein BONZAI 3-like [Vitis vinifera] Length = 594 Score = 68.2 bits (165), Expect = 1e-09 Identities = 37/58 (63%), Positives = 41/58 (70%) Frame = +2 Query: 2 FVPMREAHGAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLSIGEHRPSTSYAT 175 FVPMRE G Q S+VQALL+ELPGQFL YMRSRDI P +VN Q STS+AT Sbjct: 543 FVPMREVRGGQTSVVQALLEELPGQFLTYMRSRDIKPGAVNIAQ-------TSTSHAT 593 >ref|XP_002265395.2| PREDICTED: protein BONZAI 3-like [Vitis vinifera] Length = 594 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = +2 Query: 2 FVPMREAHGAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLS 139 FVPMRE G Q S+VQALL+ELPGQFL YMRSRDI P +VN Q S Sbjct: 543 FVPMREVRGGQTSVVQALLEELPGQFLTYMRSRDIKPGAVNIAQTS 588 >ref|XP_003633350.1| PREDICTED: protein BONZAI 3-like [Vitis vinifera] Length = 594 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = +2 Query: 2 FVPMREAHGAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLS 139 FVPMRE G Q S+VQALL+ELPGQFL YMRSRDI P +VN Q S Sbjct: 543 FVPMREVRGGQTSVVQALLEELPGQFLTYMRSRDIKPGAVNIAQTS 588 >ref|XP_002267420.1| PREDICTED: protein BONZAI 3-like [Vitis vinifera] Length = 594 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = +2 Query: 2 FVPMREAHGAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLS 139 FVPMRE G Q S+VQALL+ELPGQFL YMRSRDI P +VN Q S Sbjct: 543 FVPMREVRGGQTSVVQALLEELPGQFLTYMRSRDIKPGAVNIAQTS 588 >emb|CAN68494.1| hypothetical protein VITISV_022266 [Vitis vinifera] Length = 601 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = +2 Query: 2 FVPMREAHGAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLS 139 FVPMRE G Q S+VQALL+ELPGQFL YMRSRDI P +VN Q S Sbjct: 550 FVPMREVRGGQTSVVQALLEELPGQFLTYMRSRDIKPGAVNIAQTS 595 >emb|CAN74634.1| hypothetical protein VITISV_032757 [Vitis vinifera] Length = 601 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = +2 Query: 2 FVPMREAHGAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLS 139 FVPMRE G Q S+VQALL+ELPGQFL YMRSRDI P +VN Q S Sbjct: 550 FVPMREVRGGQTSVVQALLEELPGQFLTYMRSRDIKPGAVNIAQTS 595 >ref|XP_006341333.1| PREDICTED: protein BONZAI 3-like isoform X2 [Solanum tuberosum] Length = 541 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +2 Query: 2 FVPMREAHGAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLSIGEHRPSTSY 169 FVPMRE H + S+VQALL+ELPGQFL YMR RDI PH+++ Q S P SY Sbjct: 488 FVPMREVHSGKISVVQALLEELPGQFLTYMRCRDIRPHNISAPQTS----APGPSY 539 >ref|XP_006341332.1| PREDICTED: protein BONZAI 3-like isoform X1 [Solanum tuberosum] Length = 595 Score = 65.5 bits (158), Expect = 7e-09 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +2 Query: 2 FVPMREAHGAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLSIGEHRPSTSY 169 FVPMRE H + S+VQALL+ELPGQFL YMR RDI PH+++ Q S P SY Sbjct: 542 FVPMREVHSGKISVVQALLEELPGQFLTYMRCRDIRPHNISAPQTS----APGPSY 593 >emb|CBI34312.3| unnamed protein product [Vitis vinifera] Length = 626 Score = 64.3 bits (155), Expect = 2e-08 Identities = 34/47 (72%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = +2 Query: 2 FVPMREAH-GAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLS 139 FVPMRE G Q S+VQALLQELPGQFL YMRSRDI P +VN Q S Sbjct: 574 FVPMREVRAGGQTSVVQALLQELPGQFLTYMRSRDIKPSAVNIAQTS 620 >ref|XP_002512304.1| copine, putative [Ricinus communis] gi|223548265|gb|EEF49756.1| copine, putative [Ricinus communis] Length = 581 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = +2 Query: 2 FVPMREAHGAQGSIVQALLQELPGQFLAYMRSRDILPHS 118 FVPMRE H Q S VQALL+ELPGQFL+YMRSRDI PH+ Sbjct: 539 FVPMREVHSGQLSAVQALLEELPGQFLSYMRSRDIKPHA 577 >emb|CBI34306.3| unnamed protein product [Vitis vinifera] Length = 698 Score = 63.5 bits (153), Expect = 3e-08 Identities = 37/59 (62%), Positives = 41/59 (69%), Gaps = 1/59 (1%) Frame = +2 Query: 2 FVPMREAH-GAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLSIGEHRPSTSYAT 175 FVPMRE G Q S+VQALL+ELPGQFL YMRSRDI P +VN Q STS+AT Sbjct: 615 FVPMREVRAGGQTSVVQALLEELPGQFLTYMRSRDIKPGAVNIAQ-------TSTSHAT 666 >emb|CBI34309.3| unnamed protein product [Vitis vinifera] Length = 639 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/47 (70%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = +2 Query: 2 FVPMREAH-GAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLS 139 FVPMRE G Q S+VQALL+ELPGQFL YMRSRDI P +VN Q S Sbjct: 561 FVPMREVRAGGQTSVVQALLEELPGQFLTYMRSRDIKPGAVNIAQTS 607 >emb|CBI34308.3| unnamed protein product [Vitis vinifera] Length = 521 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/47 (70%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = +2 Query: 2 FVPMREAH-GAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLS 139 FVPMRE G Q S+VQALL+ELPGQFL YMRSRDI P +VN Q S Sbjct: 469 FVPMREVRAGGQTSVVQALLEELPGQFLTYMRSRDIKPGAVNIAQTS 515 >emb|CBI40680.3| unnamed protein product [Vitis vinifera] Length = 626 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/47 (70%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = +2 Query: 2 FVPMREAH-GAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLS 139 FVPMRE G Q S+VQALL+ELPGQFL YMRSRDI P +VN Q S Sbjct: 543 FVPMREVRAGGQTSVVQALLEELPGQFLTYMRSRDIKPGAVNIAQTS 589 >ref|XP_004248957.1| PREDICTED: protein BONZAI 3-like [Solanum lycopersicum] Length = 367 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +2 Query: 2 FVPMREAHGAQGSIVQALLQELPGQFLAYMRSRDILPHSVN 124 FVPM+E H Q S+V+ALL+ELPGQFL YMR RDI PH+++ Sbjct: 319 FVPMQEVHSGQISVVEALLEELPGQFLTYMRCRDIRPHNIS 359 >gb|EXB67641.1| Protein BONZAI 3 [Morus notabilis] Length = 579 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = +2 Query: 2 FVPMREAHGAQGSIVQALLQELPGQFLAYMRSRDILPHSVNDGQLSI 142 FVPMR+ H Q S VQALL+ELPGQFL Y+RSRDI P +++ Q S+ Sbjct: 533 FVPMRDVHSGQISAVQALLEELPGQFLTYVRSRDIKPSNLSAAQTSV 579