BLASTX nr result
ID: Sinomenium21_contig00040892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00040892 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38593.1| hypothetical protein MIMGU_mgv1a000436mg [Mimulus... 61 2e-07 ref|XP_002284049.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 ... 60 3e-07 ref|XP_002322903.2| hypothetical protein POPTR_0016s10980g [Popu... 60 4e-07 gb|EPS71373.1| ubiquitin-protein ligase 7, partial [Genlisea aurea] 60 4e-07 ref|XP_006366787.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-... 59 7e-07 ref|XP_004246588.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-... 59 7e-07 ref|XP_004161270.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-... 59 9e-07 ref|XP_004137861.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-... 59 9e-07 ref|XP_004494118.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-... 58 1e-06 ref|XP_007204674.1| hypothetical protein PRUPE_ppa000451mg [Prun... 58 1e-06 ref|XP_006481928.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-... 58 2e-06 ref|XP_006481927.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-... 58 2e-06 ref|XP_007162827.1| hypothetical protein PHAVU_001G184300g [Phas... 58 2e-06 ref|XP_006430344.1| hypothetical protein CICLE_v100109402mg, par... 58 2e-06 ref|XP_003553574.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 ... 58 2e-06 gb|ACU16219.1| unknown [Glycine max] 58 2e-06 ref|XP_006403726.1| hypothetical protein EUTSA_v10010078mg [Eutr... 57 3e-06 ref|XP_006838751.1| hypothetical protein AMTR_s00002p00255750 [A... 57 3e-06 ref|XP_006290524.1| hypothetical protein CARUB_v10016604mg [Caps... 57 3e-06 ref|XP_002876188.1| ubiquitin-protein ligase 7 [Arabidopsis lyra... 57 3e-06 >gb|EYU38593.1| hypothetical protein MIMGU_mgv1a000436mg [Mimulus guttatus] Length = 1156 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKRA+TL+AKLLYAINSNAGFELS Sbjct: 1126 NTLKLPTYKRASTLKAKLLYAINSNAGFELS 1156 >ref|XP_002284049.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 [Vitis vinifera] gi|297740027|emb|CBI30209.3| unnamed protein product [Vitis vinifera] Length = 1161 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKR +TLRAKLLYAINSNAGFELS Sbjct: 1131 NTLKLPTYKRPSTLRAKLLYAINSNAGFELS 1161 >ref|XP_002322903.2| hypothetical protein POPTR_0016s10980g [Populus trichocarpa] gi|550321241|gb|EEF04664.2| hypothetical protein POPTR_0016s10980g [Populus trichocarpa] Length = 1173 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKRA+TLRAK+LYAINSN GFELS Sbjct: 1143 NTLKLPTYKRASTLRAKILYAINSNTGFELS 1173 >gb|EPS71373.1| ubiquitin-protein ligase 7, partial [Genlisea aurea] Length = 1145 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTY+RA+TLR+KLLYAINSNAGFELS Sbjct: 1115 NTLKLPTYRRASTLRSKLLYAINSNAGFELS 1145 >ref|XP_006366787.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like isoform X1 [Solanum tuberosum] Length = 1160 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKR TLRAKLLYAINSNAGFELS Sbjct: 1130 NTLKLPTYKRQNTLRAKLLYAINSNAGFELS 1160 >ref|XP_004246588.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like [Solanum lycopersicum] Length = 1160 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKR TLRAKLLYAINSNAGFELS Sbjct: 1130 NTLKLPTYKRQNTLRAKLLYAINSNAGFELS 1160 >ref|XP_004161270.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like [Cucumis sativus] Length = 833 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKR++TLR+KLLYAINSN+GFELS Sbjct: 803 NTLKLPTYKRSSTLRSKLLYAINSNSGFELS 833 >ref|XP_004137861.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like [Cucumis sativus] Length = 1169 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKR++TLR+KLLYAINSN+GFELS Sbjct: 1139 NTLKLPTYKRSSTLRSKLLYAINSNSGFELS 1169 >ref|XP_004494118.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like isoform X1 [Cicer arietinum] gi|502111639|ref|XP_004494119.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like isoform X2 [Cicer arietinum] Length = 1162 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKR +TLRAKLLYAI+SNAGFELS Sbjct: 1132 NTLKLPTYKRPSTLRAKLLYAISSNAGFELS 1162 >ref|XP_007204674.1| hypothetical protein PRUPE_ppa000451mg [Prunus persica] gi|462400205|gb|EMJ05873.1| hypothetical protein PRUPE_ppa000451mg [Prunus persica] Length = 1167 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKR +TLRAKLLYAI+SNAGFELS Sbjct: 1137 NTLKLPTYKRPSTLRAKLLYAISSNAGFELS 1167 >ref|XP_006481928.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like isoform X2 [Citrus sinensis] Length = 1036 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKR++TL+AKLLYAI+SNAGFELS Sbjct: 1006 NTLKLPTYKRSSTLKAKLLYAISSNAGFELS 1036 >ref|XP_006481927.1| PREDICTED: E3 ubiquitin-protein ligase UPL7-like isoform X1 [Citrus sinensis] Length = 1150 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKR++TL+AKLLYAI+SNAGFELS Sbjct: 1120 NTLKLPTYKRSSTLKAKLLYAISSNAGFELS 1150 >ref|XP_007162827.1| hypothetical protein PHAVU_001G184300g [Phaseolus vulgaris] gi|593799580|ref|XP_007162828.1| hypothetical protein PHAVU_001G184300g [Phaseolus vulgaris] gi|561036291|gb|ESW34821.1| hypothetical protein PHAVU_001G184300g [Phaseolus vulgaris] gi|561036292|gb|ESW34822.1| hypothetical protein PHAVU_001G184300g [Phaseolus vulgaris] Length = 1157 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKR TLRAKLLYAI+SNAGFELS Sbjct: 1127 NTLKLPTYKRPGTLRAKLLYAISSNAGFELS 1157 >ref|XP_006430344.1| hypothetical protein CICLE_v100109402mg, partial [Citrus clementina] gi|557532401|gb|ESR43584.1| hypothetical protein CICLE_v100109402mg, partial [Citrus clementina] Length = 759 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKR++TL+AKLLYAI+SNAGFELS Sbjct: 729 NTLKLPTYKRSSTLKAKLLYAISSNAGFELS 759 >ref|XP_003553574.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X1 [Glycine max] gi|571558707|ref|XP_006604604.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X2 [Glycine max] gi|571558711|ref|XP_006604605.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X3 [Glycine max] gi|571558715|ref|XP_006604606.1| PREDICTED: E3 ubiquitin-protein ligase UPL7 isoform X4 [Glycine max] Length = 1157 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKR TLRAKLLYAI+SNAGFELS Sbjct: 1127 NTLKLPTYKRPGTLRAKLLYAISSNAGFELS 1157 >gb|ACU16219.1| unknown [Glycine max] Length = 85 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKR TLRAKLLYAI+SNAGFELS Sbjct: 55 NTLKLPTYKRPGTLRAKLLYAISSNAGFELS 85 >ref|XP_006403726.1| hypothetical protein EUTSA_v10010078mg [Eutrema salsugineum] gi|557104845|gb|ESQ45179.1| hypothetical protein EUTSA_v10010078mg [Eutrema salsugineum] Length = 1143 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKRA+T+R KLLYAI SNAGFELS Sbjct: 1113 NTLKLPTYKRASTMREKLLYAITSNAGFELS 1143 >ref|XP_006838751.1| hypothetical protein AMTR_s00002p00255750 [Amborella trichopoda] gi|548841257|gb|ERN01320.1| hypothetical protein AMTR_s00002p00255750 [Amborella trichopoda] Length = 1157 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKR+ATLR KL+YAI+SNAGFELS Sbjct: 1127 NTLKLPTYKRSATLRNKLIYAISSNAGFELS 1157 >ref|XP_006290524.1| hypothetical protein CARUB_v10016604mg [Capsella rubella] gi|482559231|gb|EOA23422.1| hypothetical protein CARUB_v10016604mg [Capsella rubella] Length = 1142 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKRA+T+R KLLYAI SNAGFELS Sbjct: 1112 NTLKLPTYKRASTMREKLLYAITSNAGFELS 1142 >ref|XP_002876188.1| ubiquitin-protein ligase 7 [Arabidopsis lyrata subsp. lyrata] gi|297322026|gb|EFH52447.1| ubiquitin-protein ligase 7 [Arabidopsis lyrata subsp. lyrata] Length = 1130 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 NTLKLPTYKRAATLRAKLLYAINSNAGFELS 95 NTLKLPTYKRA+T+R KLLYAI SNAGFELS Sbjct: 1100 NTLKLPTYKRASTMREKLLYAITSNAGFELS 1130