BLASTX nr result
ID: Sinomenium21_contig00040885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00040885 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGT40332.1| APS reductase [Nicotiana attenuata] 56 4e-06 gb|AGT40337.1| APS reductase [Nicotiana attenuata] 55 1e-05 >gb|AGT40332.1| APS reductase [Nicotiana attenuata] Length = 460 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/42 (66%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = -3 Query: 285 GVKVGKLMAD-EHKTLAQQELHLGSFPTILIFPKNTSKSFSW 163 GVKVGK AD E K AQQEL LGSFPTIL+FPK++SK+ + Sbjct: 401 GVKVGKFRADGEQKAFAQQELQLGSFPTILLFPKHSSKAIKY 442 >gb|AGT40337.1| APS reductase [Nicotiana attenuata] Length = 465 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/42 (66%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -3 Query: 285 GVKVGKLMAD-EHKTLAQQELHLGSFPTILIFPKNTSKSFSW 163 GVKVGK AD E KT AQQEL LGSFPTIL FPK++S+ + Sbjct: 406 GVKVGKFRADGEQKTFAQQELQLGSFPTILFFPKHSSQPIKY 447