BLASTX nr result
ID: Sinomenium21_contig00040782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00040782 (674 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB36954.1| hypothetical protein L484_018330 [Morus notabilis] 89 1e-15 >gb|EXB36954.1| hypothetical protein L484_018330 [Morus notabilis] Length = 217 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +3 Query: 81 HCWKGSASKPYVELPPHTAPLGMEVGPAQACAVKVVVHDL 200 HCWKGSASKPYVELPPHTAPLGMEVGP QACAVKVVVHDL Sbjct: 57 HCWKGSASKPYVELPPHTAPLGMEVGPTQACAVKVVVHDL 96