BLASTX nr result
ID: Sinomenium21_contig00040415
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00040415 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC35009.1| DNA topoisomerase 3-alpha [Morus notabilis] 56 6e-06 >gb|EXC35009.1| DNA topoisomerase 3-alpha [Morus notabilis] Length = 342 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/48 (43%), Positives = 29/48 (60%), Gaps = 12/48 (25%) Frame = -1 Query: 108 NCFRCGREGHWIRDCSIRATN------------SVCVKCGRFGHWKKD 1 +CF+CG+EGHW RDCS+ ++N C KCG+ GHW +D Sbjct: 291 SCFKCGKEGHWARDCSVPSSNPAAELGGRSASSGTCYKCGKPGHWSRD 338