BLASTX nr result
ID: Sinomenium21_contig00040319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00040319 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDH30699.1| putative Ty1-copia-like retrotransposon [Cercis ... 54 2e-06 >emb|CDH30699.1| putative Ty1-copia-like retrotransposon [Cercis chinensis] Length = 646 Score = 53.5 bits (127), Expect(2) = 2e-06 Identities = 34/87 (39%), Positives = 49/87 (56%), Gaps = 7/87 (8%) Frame = -2 Query: 289 VLQGPTDRGLNRFPTSGSKVSSTFSQASCYSIFTLNKTAS-----LWYDRLGHPTMLIVN 125 +L+G D+GL P S SS QA + IF+ + + S LW++RLGHP++ IVN Sbjct: 468 LLKGGLDKGLYSVP---SAYSSHAPQARVFQIFSTSSSTSIDSMRLWHNRLGHPSLAIVN 524 Query: 124 KMLGCCSLPTVKTSN--FCNS*QLLKA 50 K+L +LP N C+S QL K+ Sbjct: 525 KVLNHYNLPVFSLQNKLLCDSCQLAKS 551 Score = 23.5 bits (49), Expect(2) = 2e-06 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 Query: 62 IAKSHRLGCVLSSLKSIKPF 3 +AKSH+L V + K++KPF Sbjct: 548 LAKSHKLPFVRNYSKAMKPF 567