BLASTX nr result
ID: Sinomenium21_contig00040264
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00040264 (441 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306949.1| hypothetical protein POPTR_0005s26440g [Popu... 62 6e-08 >ref|XP_002306949.1| hypothetical protein POPTR_0005s26440g [Populus trichocarpa] gi|222856398|gb|EEE93945.1| hypothetical protein POPTR_0005s26440g [Populus trichocarpa] Length = 427 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +1 Query: 310 MEPVASMVDKLKGLAKSSEEFVKGIFQRHNCSARHNPIEILKRL 441 MEPVAS+VDK+KG+AKS ++FV G+ +R S+R NPIEILKRL Sbjct: 1 MEPVASVVDKIKGVAKSGQDFVDGLLRRRENSSRRNPIEILKRL 44