BLASTX nr result
ID: Sinomenium21_contig00039774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00039774 (507 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004289367.1| PREDICTED: putative ribonuclease H protein A... 47 3e-06 ref|XP_007198897.1| hypothetical protein PRUPE_ppa015748mg, part... 52 5e-06 >ref|XP_004289367.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Fragaria vesca subsp. vesca] Length = 1152 Score = 46.6 bits (109), Expect(2) = 3e-06 Identities = 21/42 (50%), Positives = 27/42 (64%) Frame = -1 Query: 507 DRKIIQSIPISTYGCSDELVWHHTRDGSYSVKTGYFVAKDLD 382 + +II IP+S G D LVWH G Y+VK+GYFV + LD Sbjct: 743 ESEIILKIPLSLNGGEDRLVWHFDNKGCYNVKSGYFVGRLLD 784 Score = 30.0 bits (66), Expect(2) = 3e-06 Identities = 19/69 (27%), Positives = 26/69 (37%), Gaps = 19/69 (27%) Frame = -3 Query: 331 RCWQDIWKLKVPNKLKIFMRRXXXXXXXXXXXL-------------------EDGLHLFF 209 R W +W+ +VP K+++ R L ED LHLF Sbjct: 801 RLWCKLWRTQVPPKVRMHAWRLVKGTLPSRAALVKKQVQLPDVNCVFCSTNVEDSLHLFK 860 Query: 208 KCQASQAFW 182 C+A Q FW Sbjct: 861 NCEALQPFW 869 >ref|XP_007198897.1| hypothetical protein PRUPE_ppa015748mg, partial [Prunus persica] gi|462394192|gb|EMJ00096.1| hypothetical protein PRUPE_ppa015748mg, partial [Prunus persica] Length = 949 Score = 52.0 bits (123), Expect(2) = 5e-06 Identities = 21/41 (51%), Positives = 31/41 (75%) Frame = -1 Query: 495 IQSIPISTYGCSDELVWHHTRDGSYSVKTGYFVAKDLDRNG 373 I ++ +S +GC D L+WH T++G Y+VK+GY VA +LD NG Sbjct: 763 ILAMALSRFGCPDHLMWHFTKNGLYTVKSGYRVAVELDSNG 803 Score = 23.9 bits (50), Expect(2) = 5e-06 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 331 RCWQDIWKLKVPNKLKIFMR 272 R W+ IW L V +K++ F + Sbjct: 821 RLWKSIWGLNVASKIRHFTK 840