BLASTX nr result
ID: Sinomenium21_contig00039757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00039757 (536 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20487.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_002282842.1| PREDICTED: dihydroflavonol-4-reductase-like ... 67 2e-09 ref|XP_003607711.1| Dihydroflavonol-4-reductase [Medicago trunca... 59 1e-06 ref|XP_003539568.1| PREDICTED: dihydroflavonol-4-reductase-like ... 58 1e-06 ref|XP_003636715.1| Dihydroflavonol 4-reductase, partial [Medica... 58 2e-06 ref|XP_003607710.1| Dihydroflavonol-4-reductase [Medicago trunca... 57 4e-06 ref|XP_006370601.1| hypothetical protein POPTR_0001s44120g, part... 56 6e-06 ref|XP_007211514.1| hypothetical protein PRUPE_ppa008011mg [Prun... 56 6e-06 ref|XP_002522817.1| cinnamoyl-CoA reductase, putative [Ricinus c... 55 8e-06 >emb|CBI20487.3| unnamed protein product [Vitis vinifera] Length = 313 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -1 Query: 524 KEHGSLPAKISSKKLTDLGFKYKYGLQEIIEQCVKCCVQHGFLKSLR 384 +E GS P++I SKKL DLGF YKYGL++II+Q + CC+ HGFL +R Sbjct: 266 EECGSAPSEICSKKLNDLGFNYKYGLEDIIQQTINCCLDHGFLPQIR 312 >ref|XP_002282842.1| PREDICTED: dihydroflavonol-4-reductase-like [Vitis vinifera] Length = 354 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -1 Query: 524 KEHGSLPAKISSKKLTDLGFKYKYGLQEIIEQCVKCCVQHGFLKSLR 384 +E GS P++I SKKL DLGF YKYGL++II+Q + CC+ HGFL +R Sbjct: 307 EECGSAPSEICSKKLNDLGFNYKYGLEDIIQQTINCCLDHGFLPQIR 353 >ref|XP_003607711.1| Dihydroflavonol-4-reductase [Medicago truncatula] gi|355508766|gb|AES89908.1| Dihydroflavonol-4-reductase [Medicago truncatula] Length = 130 Score = 58.5 bits (140), Expect = 1e-06 Identities = 23/50 (46%), Positives = 37/50 (74%) Frame = -1 Query: 536 QRSWKEHGSLPAKISSKKLTDLGFKYKYGLQEIIEQCVKCCVQHGFLKSL 387 QR +++ +P +ISSKK+ DLGF YK+ L+EI+ Q + CC+ +G+L S+ Sbjct: 81 QRKSQKYDKVPTEISSKKIKDLGFSYKHSLEEIVHQTIMCCLDYGYLPSV 130 >ref|XP_003539568.1| PREDICTED: dihydroflavonol-4-reductase-like [Glycine max] Length = 359 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/47 (48%), Positives = 37/47 (78%) Frame = -1 Query: 524 KEHGSLPAKISSKKLTDLGFKYKYGLQEIIEQCVKCCVQHGFLKSLR 384 K + ++P++ISSKKL +LGF YK+GL++II Q + CC+ +G+L +R Sbjct: 312 KNYDNVPSEISSKKLKELGFSYKHGLEDIIHQTIICCLDYGYLPPIR 358 >ref|XP_003636715.1| Dihydroflavonol 4-reductase, partial [Medicago truncatula] gi|355502650|gb|AES83853.1| Dihydroflavonol 4-reductase, partial [Medicago truncatula] Length = 208 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/55 (41%), Positives = 38/55 (69%) Frame = -1 Query: 533 RSWKEHGSLPAKISSKKLTDLGFKYKYGLQEIIEQCVKCCVQHGFLKSLR*WWLS 369 R +++ +P +ISSKK+ DLGF YK+ L+EI+ Q + CC+ +G+L S W++ Sbjct: 118 RKSQKYDKVPTEISSKKIKDLGFSYKHSLEEIVHQTIMCCLDYGYLPSEHTRWIT 172 >ref|XP_003607710.1| Dihydroflavonol-4-reductase [Medicago truncatula] gi|355508765|gb|AES89907.1| Dihydroflavonol-4-reductase [Medicago truncatula] Length = 131 Score = 56.6 bits (135), Expect = 4e-06 Identities = 22/49 (44%), Positives = 36/49 (73%) Frame = -1 Query: 533 RSWKEHGSLPAKISSKKLTDLGFKYKYGLQEIIEQCVKCCVQHGFLKSL 387 R +++ +P +ISSKK+ DLGF YK+ L+EI+ Q + CC+ +G+L S+ Sbjct: 83 RKSQKYDKVPTEISSKKIKDLGFSYKHSLEEIVHQTIMCCLDYGYLPSV 131 >ref|XP_006370601.1| hypothetical protein POPTR_0001s44120g, partial [Populus trichocarpa] gi|550349807|gb|ERP67170.1| hypothetical protein POPTR_0001s44120g, partial [Populus trichocarpa] Length = 306 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/47 (48%), Positives = 35/47 (74%) Frame = -1 Query: 536 QRSWKEHGSLPAKISSKKLTDLGFKYKYGLQEIIEQCVKCCVQHGFL 396 QR ++ GS+ +ISSKKL D+GFKYK+ +++II + + CC+ GFL Sbjct: 258 QRLAEKQGSISPEISSKKLRDMGFKYKHSIKDIISETITCCLDQGFL 304 >ref|XP_007211514.1| hypothetical protein PRUPE_ppa008011mg [Prunus persica] gi|462407379|gb|EMJ12713.1| hypothetical protein PRUPE_ppa008011mg [Prunus persica] Length = 349 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = -1 Query: 509 LPAKISSKKLTDLGFKYKYGLQEIIEQCVKCCVQHGFLKSL 387 +P++ISSKKLTDLGF +K+GL++II Q + C+ +GFL SL Sbjct: 309 VPSEISSKKLTDLGFSFKHGLEDIIHQTITTCLGYGFLPSL 349 >ref|XP_002522817.1| cinnamoyl-CoA reductase, putative [Ricinus communis] gi|223537901|gb|EEF39515.1| cinnamoyl-CoA reductase, putative [Ricinus communis] Length = 401 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/46 (47%), Positives = 35/46 (76%) Frame = -1 Query: 521 EHGSLPAKISSKKLTDLGFKYKYGLQEIIEQCVKCCVQHGFLKSLR 384 + GS+P++ISSKKL +LGF +K+ +++II + + CCV +GFL R Sbjct: 301 KEGSIPSEISSKKLRELGFTFKHDIKDIIRETISCCVDYGFLAHTR 346