BLASTX nr result
ID: Sinomenium21_contig00039542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00039542 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006851004.1| hypothetical protein AMTR_s00025p00218070 [A... 62 8e-08 >ref|XP_006851004.1| hypothetical protein AMTR_s00025p00218070 [Amborella trichopoda] gi|548854675|gb|ERN12585.1| hypothetical protein AMTR_s00025p00218070 [Amborella trichopoda] Length = 313 Score = 62.0 bits (149), Expect = 8e-08 Identities = 33/75 (44%), Positives = 44/75 (58%) Frame = -1 Query: 226 KPPTGWIKLNCDXXXXXXXXXXXXXGILRDAEGNMKGAFSSHYGIGTNNRAELRAIIEGV 47 KPP G +KLN D GILR+ +G AF+SHYG TN AE RA+ EGV Sbjct: 139 KPPIGILKLNVDGASSGNPGRAGGGGILRNHQGKWLIAFASHYGTTTNVAAEFRALYEGV 198 Query: 46 RLCKSLTFFRVLIES 2 +LCK + ++++ES Sbjct: 199 KLCKEEGYKKIILES 213