BLASTX nr result
ID: Sinomenium21_contig00038996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00038996 (284 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007022279.1| Pentatricopeptide repeat (PPR) superfamily p... 61 1e-07 ref|XP_002269984.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_002513427.1| pentatricopeptide repeat-containing protein,... 59 9e-07 ref|XP_004162287.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_004144640.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 >ref|XP_007022279.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508721907|gb|EOY13804.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 568 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/42 (64%), Positives = 35/42 (83%) Frame = -1 Query: 128 LLHSISPLSNPTSSTSRKACCFFSQIPNLHTLSLTKGFSRVL 3 LL+S+SP++NP+ T+RK C FF QIPNLH+ SL KGF+RVL Sbjct: 4 LLNSMSPMTNPSPETTRKTCGFFYQIPNLHSFSLNKGFTRVL 45 >ref|XP_002269984.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Vitis vinifera] gi|147852271|emb|CAN82234.1| hypothetical protein VITISV_038804 [Vitis vinifera] Length = 567 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/42 (61%), Positives = 36/42 (85%) Frame = -1 Query: 128 LLHSISPLSNPTSSTSRKACCFFSQIPNLHTLSLTKGFSRVL 3 L++++SP+++P+ +RK C FFSQ+PNLHTLSL KGFSRVL Sbjct: 4 LVNAMSPITSPSPENARKVCGFFSQVPNLHTLSLNKGFSRVL 45 >ref|XP_002513427.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547335|gb|EEF48830.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 567 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -1 Query: 131 ALLHSISPLSNPTSSTSRKACCFFSQIPNLHTLSLTKGFSRVL 3 +L+HS+SPL+NP + +R AC FFS IPNLH+ SL K F+RVL Sbjct: 3 SLVHSVSPLTNPFTEAARIACGFFSHIPNLHSFSLNKDFTRVL 45 >ref|XP_004162287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cucumis sativus] Length = 566 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 128 LLHSISPLSNPTSSTSRKACCFFSQIPNLHTLSLTKGFSRVL 3 LL+++SP++NP+ T+R+ C FFS IPN+ LSL KGFS+VL Sbjct: 4 LLNTVSPITNPSPETTRRGCGFFSHIPNIQKLSLNKGFSKVL 45 >ref|XP_004144640.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cucumis sativus] Length = 566 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/42 (57%), Positives = 34/42 (80%) Frame = -1 Query: 128 LLHSISPLSNPTSSTSRKACCFFSQIPNLHTLSLTKGFSRVL 3 LL+++SP++NP+ T+R+ C FFS IPN+ LSL KGFS+VL Sbjct: 4 LLNTVSPITNPSPETTRRGCGFFSHIPNIQKLSLNKGFSKVL 45